BLASTX nr result
ID: Coptis25_contig00003502
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00003502 (736 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_172067.1| protein restricted tev movement 1 [Arabidopsis ... 66 1e-09 emb|CBW45829.1| RTM1 protein [Arabidopsis thaliana] 66 1e-09 gb|ADE43061.1| restricted tev movement 1 [Arabidopsis thaliana] ... 66 1e-09 gb|AAK43842.1|AF370465_1 Unknown protein [Arabidopsis thaliana] ... 66 1e-09 emb|CBW45850.1| RTM1 protein [Arabidopsis thaliana] 66 1e-09 >ref|NP_172067.1| protein restricted tev movement 1 [Arabidopsis thaliana] gi|6503088|gb|AAF14583.1|AF191302_1 RTM1 [Arabidopsis thaliana] gi|6850305|gb|AAF29382.1|AC009999_2 Contains similarity to a jasmonate inducible protein from Brassica napus gb|Y11483 and contains a Jacalin-like lectin PF|01419 domain. EST gb|AI998212 comes from this gene [Arabidopsis thaliana] gi|293337517|gb|ADE43047.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337519|gb|ADE43048.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337523|gb|ADE43050.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337525|gb|ADE43051.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337527|gb|ADE43052.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337531|gb|ADE43054.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337533|gb|ADE43055.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337535|gb|ADE43056.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337537|gb|ADE43057.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337539|gb|ADE43058.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337541|gb|ADE43059.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337543|gb|ADE43060.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337547|gb|ADE43062.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337549|gb|ADE43063.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337551|gb|ADE43064.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337553|gb|ADE43065.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337558|gb|ADE43067.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337560|gb|ADE43068.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337562|gb|ADE43069.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337564|gb|ADE43070.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337566|gb|ADE43071.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337568|gb|ADE43072.1| restricted tev movement 1 [Arabidopsis thaliana] gi|302608898|emb|CBW45825.1| RTM1 protein [Arabidopsis thaliana] gi|302608900|emb|CBW45826.1| RTM1 protein [Arabidopsis thaliana] gi|302608904|emb|CBW45828.1| RTM1 protein [Arabidopsis thaliana] gi|302608908|emb|CBW45830.1| RTM1 protein [Arabidopsis thaliana] gi|302608910|emb|CBW45831.1| RTM1 protein [Arabidopsis thaliana] gi|302608912|emb|CBW45832.1| RTM1 protein [Arabidopsis thaliana] gi|302608914|emb|CBW45833.1| RTM1 protein [Arabidopsis thaliana] gi|302608916|emb|CBW45834.1| RTM1 protein [Arabidopsis thaliana] gi|302608918|emb|CBW45835.1| RTM1 protein [Arabidopsis thaliana] gi|302608922|emb|CBW45837.1| RTM1 protein [Arabidopsis thaliana] gi|302608924|emb|CBW45838.1| RTM1 protein [Arabidopsis thaliana] gi|302608926|emb|CBW45839.1| RTM1 protein [Arabidopsis thaliana] gi|302608928|emb|CBW45840.1| RTM1 protein [Arabidopsis thaliana] gi|302608930|emb|CBW45841.1| RTM1 protein [Arabidopsis thaliana] gi|302608932|emb|CBW45842.1| RTM1 protein [Arabidopsis thaliana] gi|302608934|emb|CBW45843.1| RTM1 protein [Arabidopsis thaliana] gi|302608936|emb|CBW45844.1| RTM1 protein [Arabidopsis thaliana] gi|302608938|emb|CBW45845.1| RTM1 protein [Arabidopsis thaliana] gi|302608940|emb|CBW45846.1| RTM1 protein [Arabidopsis thaliana] gi|302608942|emb|CBW45847.1| RTM1 protein [Arabidopsis thaliana] gi|302608944|emb|CBW45848.1| RTM1 protein [Arabidopsis thaliana] gi|302608946|emb|CBW45849.1| RTM1 protein [Arabidopsis thaliana] gi|302608952|emb|CBW45852.1| RTM1 protein [Arabidopsis thaliana] gi|302608954|emb|CBW45853.1| RTM1 protein [Arabidopsis thaliana] gi|302608956|emb|CBW45854.1| RTM1 protein [Arabidopsis thaliana] gi|302608958|emb|CBW45855.1| RTM1 protein [Arabidopsis thaliana] gi|332189767|gb|AEE27888.1| protein restricted tev movement 1 [Arabidopsis thaliana] Length = 174 Score = 66.2 bits (160), Expect(2) = 1e-09 Identities = 36/87 (41%), Positives = 53/87 (60%), Gaps = 6/87 (6%) Frame = -2 Query: 387 VVLNYPSEYLTGIEGECSDHYRHGIILASLVFHTNQRKFGPFGDDKADSD-FSFKTGEA- 214 + LNYP EY+TGI GE + + + SL F+TN ++GPFG + +D F+FK G++ Sbjct: 70 IELNYPHEYITGISGEYYKYEANNPHMRSLKFNTNTSEYGPFGTSGSSNDKFAFKLGKSP 129 Query: 213 ----FYGYSDEQYLRGIGVYVKPKACL 145 F+G D L+ IGVY++PK L Sbjct: 130 QFGGFHGTYDASGLQYIGVYLRPKTVL 156 Score = 22.3 bits (46), Expect(2) = 1e-09 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 550 MLIGFGSAQDGDEKSLVLSDRHG 482 M I F DG LVLSDRHG Sbjct: 41 MSIQFQFVMDG---KLVLSDRHG 60 >emb|CBW45829.1| RTM1 protein [Arabidopsis thaliana] Length = 174 Score = 66.2 bits (160), Expect(2) = 1e-09 Identities = 36/87 (41%), Positives = 53/87 (60%), Gaps = 6/87 (6%) Frame = -2 Query: 387 VVLNYPSEYLTGIEGECSDHYRHGIILASLVFHTNQRKFGPFGDDKADSD-FSFKTGEA- 214 + LNYP EY+TGI GE + + + SL F+TN ++GPFG + +D F+FK G++ Sbjct: 70 IELNYPHEYITGISGEYYKYEANNPHMRSLKFNTNTSEYGPFGTSGSSNDKFAFKLGKSP 129 Query: 213 ----FYGYSDEQYLRGIGVYVKPKACL 145 F+G D L+ IGVY++PK L Sbjct: 130 QFGGFHGTYDASGLQYIGVYLRPKTVL 156 Score = 22.3 bits (46), Expect(2) = 1e-09 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 550 MLIGFGSAQDGDEKSLVLSDRHG 482 M I F DG LVLSDRHG Sbjct: 41 MSIQFQFVMDG---KLVLSDRHG 60 >gb|ADE43061.1| restricted tev movement 1 [Arabidopsis thaliana] gi|293337555|gb|ADE43066.1| restricted tev movement 1 [Arabidopsis thaliana] Length = 174 Score = 66.2 bits (160), Expect(2) = 1e-09 Identities = 36/87 (41%), Positives = 53/87 (60%), Gaps = 6/87 (6%) Frame = -2 Query: 387 VVLNYPSEYLTGIEGECSDHYRHGIILASLVFHTNQRKFGPFGDDKADSD-FSFKTGEA- 214 + LNYP EY+TGI GE + + + SL F+TN ++GPFG + +D F+FK G++ Sbjct: 70 IELNYPHEYITGISGEYYKYEANNPHMRSLKFNTNTSEYGPFGTSGSSNDKFAFKLGKSP 129 Query: 213 ----FYGYSDEQYLRGIGVYVKPKACL 145 F+G D L+ IGVY++PK L Sbjct: 130 QFGGFHGTYDASGLQYIGVYLRPKTVL 156 Score = 22.3 bits (46), Expect(2) = 1e-09 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 550 MLIGFGSAQDGDEKSLVLSDRHG 482 M I F DG LVLSDRHG Sbjct: 41 MSIQFQFVMDG---KLVLSDRHG 60 >gb|AAK43842.1|AF370465_1 Unknown protein [Arabidopsis thaliana] gi|17978785|gb|AAL47386.1| unknown protein [Arabidopsis thaliana] Length = 174 Score = 66.2 bits (160), Expect(2) = 1e-09 Identities = 36/87 (41%), Positives = 53/87 (60%), Gaps = 6/87 (6%) Frame = -2 Query: 387 VVLNYPSEYLTGIEGECSDHYRHGIILASLVFHTNQRKFGPFGDDKADSD-FSFKTGEA- 214 + LNYP EY+TGI GE + + + SL F+TN ++GPFG + +D F+FK G++ Sbjct: 70 IELNYPHEYITGISGEYYKYEANNPHMRSLKFNTNTSEYGPFGTSGSSNDKFAFKLGKSP 129 Query: 213 ----FYGYSDEQYLRGIGVYVKPKACL 145 F+G D L+ IGVY++PK L Sbjct: 130 QFGGFHGTYDASGLQYIGVYLRPKTVL 156 Score = 22.3 bits (46), Expect(2) = 1e-09 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 550 MLIGFGSAQDGDEKSLVLSDRHG 482 M I F DG LVLSDRHG Sbjct: 41 MSIQFQFVMDG---KLVLSDRHG 60 >emb|CBW45850.1| RTM1 protein [Arabidopsis thaliana] Length = 168 Score = 66.2 bits (160), Expect(2) = 1e-09 Identities = 36/87 (41%), Positives = 53/87 (60%), Gaps = 6/87 (6%) Frame = -2 Query: 387 VVLNYPSEYLTGIEGECSDHYRHGIILASLVFHTNQRKFGPFGDDKADSD-FSFKTGEA- 214 + LNYP EY+TGI GE + + + SL F+TN ++GPFG + +D F+FK G++ Sbjct: 70 IELNYPHEYITGISGEYYKYEANNPHMRSLKFNTNTSEYGPFGTSGSSNDKFAFKLGKSP 129 Query: 213 ----FYGYSDEQYLRGIGVYVKPKACL 145 F+G D L+ IGVY++PK L Sbjct: 130 QFGGFHGTYDASGLQYIGVYLRPKTVL 156 Score = 22.3 bits (46), Expect(2) = 1e-09 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -1 Query: 550 MLIGFGSAQDGDEKSLVLSDRHG 482 M I F DG LVLSDRHG Sbjct: 41 MSIQFQFVMDG---KLVLSDRHG 60