BLASTX nr result
ID: Coptis25_contig00003412
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00003412 (327 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|A2A1A0.1|NCS1_COPJA RecName: Full=S-norcoclaurine synthase 1;... 60 2e-07 >sp|A2A1A0.1|NCS1_COPJA RecName: Full=S-norcoclaurine synthase 1; Short=CjNCS1 gi|123720767|dbj|BAF45337.1| norcoclaurine synthase [Coptis japonica var. dissecta] gi|301072256|gb|ADK56103.1| 2OG/Fe(II)-dependent dioxygenase-like protein [synthetic construct] Length = 352 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 92 RETMEKYSMQLQKLAMCLTGMMAKNLGLES 3 RETMEKYSM+LQK+AMCLTGMMAKNLGLES Sbjct: 166 RETMEKYSMELQKVAMCLTGMMAKNLGLES 195