BLASTX nr result
ID: Coptis25_contig00002922
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00002922 (370 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263238.1| PREDICTED: deoxyhypusine hydroxylase [Vitis ... 65 6e-09 dbj|BAJ96666.1| predicted protein [Hordeum vulgare subsp. vulgare] 62 4e-08 gb|EEC69714.1| hypothetical protein OsI_39196 [Oryza sativa Indi... 61 8e-08 gb|AFW74079.1| HEAT-like protein [Zea mays] 60 1e-07 gb|AFW74077.1| hypothetical protein ZEAMMB73_565525 [Zea mays] 60 1e-07 >ref|XP_002263238.1| PREDICTED: deoxyhypusine hydroxylase [Vitis vinifera] gi|297744120|emb|CBI37090.3| unnamed protein product [Vitis vinifera] Length = 315 Score = 65.1 bits (157), Expect = 6e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -3 Query: 368 VSQSCEVALSMLEFERSGKSFEYLFMQTPQVQ 273 VSQSCEVAL+MLEFERSGKSFEYLFMQTPQVQ Sbjct: 284 VSQSCEVALTMLEFERSGKSFEYLFMQTPQVQ 315 >dbj|BAJ96666.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 310 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -3 Query: 368 VSQSCEVALSMLEFERSGKSFEYLFMQTPQVQ 273 VSQSCEVALSMLE+ERSGKSFE+LF+QTPQVQ Sbjct: 276 VSQSCEVALSMLEYERSGKSFEFLFLQTPQVQ 307 >gb|EEC69714.1| hypothetical protein OsI_39196 [Oryza sativa Indica Group] Length = 302 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -3 Query: 368 VSQSCEVALSMLEFERSGKSFEYLFMQTPQVQ 273 VSQSCEVALSMLE+ERSGK+FE+LF+QTPQVQ Sbjct: 268 VSQSCEVALSMLEYERSGKAFEFLFLQTPQVQ 299 >gb|AFW74079.1| HEAT-like protein [Zea mays] Length = 330 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 368 VSQSCEVALSMLEFERSGKSFEYLFMQTPQVQ 273 VSQSCEVALSMLE+ERSGKSFE+LF+QTP VQ Sbjct: 298 VSQSCEVALSMLEYERSGKSFEFLFLQTPHVQ 329 >gb|AFW74077.1| hypothetical protein ZEAMMB73_565525 [Zea mays] Length = 241 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -3 Query: 368 VSQSCEVALSMLEFERSGKSFEYLFMQTPQVQ 273 VSQSCEVALSMLE+ERSGKSFE+LF+QTP VQ Sbjct: 209 VSQSCEVALSMLEYERSGKSFEFLFLQTPHVQ 240