BLASTX nr result
ID: Coptis25_contig00002603
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00002603 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002318909.1| cc-nbs-lrr resistance protein [Populus trich... 85 5e-15 ref|XP_002318904.1| nbs-lrr resistance protein [Populus trichoca... 84 1e-14 ref|XP_002318906.1| cc-nbs resistance protein [Populus trichocar... 84 2e-14 ref|XP_002332284.1| cc-nbs-lrr resistance protein [Populus trich... 84 2e-14 ref|XP_002332297.1| cc-nbs resistance protein [Populus trichocar... 83 2e-14 >ref|XP_002318909.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222859582|gb|EEE97129.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Length = 746 Score = 85.1 bits (209), Expect = 5e-15 Identities = 38/71 (53%), Positives = 53/71 (74%) Frame = -1 Query: 213 VTNNFEKLMWVCVSKPFDLQRVAKSIIKEATGDVPNTVAWQDLHRSLSESVRGKKFLLVL 34 VT +FEK +WVCVS+PFD R+AK+I+++ G P+ V Q L + +SES++GK+FLLVL Sbjct: 223 VTTHFEKKIWVCVSEPFDQVRIAKAILEQLEGRAPDLVELQSLLQRVSESIKGKRFLLVL 282 Query: 33 DDVWTYDREIW 1 DDVWT + W Sbjct: 283 DDVWTENHRQW 293 >ref|XP_002318904.1| nbs-lrr resistance protein [Populus trichocarpa] gi|222859577|gb|EEE97124.1| nbs-lrr resistance protein [Populus trichocarpa] Length = 799 Score = 84.0 bits (206), Expect = 1e-14 Identities = 38/71 (53%), Positives = 52/71 (73%) Frame = -1 Query: 213 VTNNFEKLMWVCVSKPFDLQRVAKSIIKEATGDVPNTVAWQDLHRSLSESVRGKKFLLVL 34 VT +FEK +WVCVS PFD ++AK+I+++ G PN V Q L + +SES++GK+FLLVL Sbjct: 132 VTAHFEKKIWVCVSDPFDEVKIAKAILEQLEGSAPNLVELQSLLQRVSESIKGKRFLLVL 191 Query: 33 DDVWTYDREIW 1 DDVWT + W Sbjct: 192 DDVWTENHGQW 202 >ref|XP_002318906.1| cc-nbs resistance protein [Populus trichocarpa] gi|222859579|gb|EEE97126.1| cc-nbs resistance protein [Populus trichocarpa] Length = 318 Score = 83.6 bits (205), Expect = 2e-14 Identities = 39/71 (54%), Positives = 52/71 (73%) Frame = -1 Query: 213 VTNNFEKLMWVCVSKPFDLQRVAKSIIKEATGDVPNTVAWQDLHRSLSESVRGKKFLLVL 34 VT++FEK +WVCVS PFD R+AK+I++E G + V Q L R +SES++GK+FLLVL Sbjct: 197 VTDHFEKKIWVCVSDPFDEVRIAKAILEELEGRASDLVGLQSLLRRVSESIKGKRFLLVL 256 Query: 33 DDVWTYDREIW 1 DDVWT + W Sbjct: 257 DDVWTENHGQW 267 >ref|XP_002332284.1| cc-nbs-lrr resistance protein [Populus trichocarpa] gi|222832446|gb|EEE70923.1| cc-nbs-lrr resistance protein [Populus trichocarpa] Length = 742 Score = 83.6 bits (205), Expect = 2e-14 Identities = 37/71 (52%), Positives = 52/71 (73%) Frame = -1 Query: 213 VTNNFEKLMWVCVSKPFDLQRVAKSIIKEATGDVPNTVAWQDLHRSLSESVRGKKFLLVL 34 VT +FEK +WVCVS+PFD R+AK+I+++ G PN + Q L + +SES++GK+ LLVL Sbjct: 197 VTAHFEKKIWVCVSEPFDEVRIAKAILEQLEGSAPNLIELQSLLQMVSESIKGKRLLLVL 256 Query: 33 DDVWTYDREIW 1 DDVWT + W Sbjct: 257 DDVWTDNHRQW 267 >ref|XP_002332297.1| cc-nbs resistance protein [Populus trichocarpa] gi|222832459|gb|EEE70936.1| cc-nbs resistance protein [Populus trichocarpa] Length = 571 Score = 83.2 bits (204), Expect = 2e-14 Identities = 38/71 (53%), Positives = 52/71 (73%) Frame = -1 Query: 213 VTNNFEKLMWVCVSKPFDLQRVAKSIIKEATGDVPNTVAWQDLHRSLSESVRGKKFLLVL 34 VT +FEK +WVCVS PFD R+AK+I+++ G P+ V Q L + +SES++GK+FLLVL Sbjct: 223 VTAHFEKKIWVCVSDPFDEVRIAKAILEQLEGRAPDLVELQSLLQRVSESIKGKRFLLVL 282 Query: 33 DDVWTYDREIW 1 DDVWT + W Sbjct: 283 DDVWTENHRQW 293