BLASTX nr result
ID: Coptis25_contig00002553
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00002553 (816 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|O22584.1|RS14_LUPLU RecName: Full=40S ribosomal protein S14 g... 57 5e-06 ref|XP_003575312.1| PREDICTED: 40S ribosomal protein S14-like [B... 57 5e-06 dbj|BAJ93777.1| predicted protein [Hordeum vulgare subsp. vulgare] 57 5e-06 gb|ELA34976.1| 40s ribosomal protein s14 [Colletotrichum gloeosp... 56 8e-06 emb|CCF42567.1| 40S ribosomal protein S14 [Colletotrichum higgin... 56 8e-06 >sp|O22584.1|RS14_LUPLU RecName: Full=40S ribosomal protein S14 gi|2565340|gb|AAB81972.1| ribosomal protein S14 [Lupinus luteus] Length = 150 Score = 57.0 bits (136), Expect = 5e-06 Identities = 31/46 (67%), Positives = 33/46 (71%) Frame = +1 Query: 337 IATRCKELGITALHIKLRAXXXXXXXXXXXXAQSALRALARSVLKI 474 +ATRCKELGITALHIKLRA AQSALRALARS +KI Sbjct: 80 VATRCKELGITALHIKLRATGGNKTKTPGRGAQSALRALARSGMKI 125 >ref|XP_003575312.1| PREDICTED: 40S ribosomal protein S14-like [Brachypodium distachyon] Length = 150 Score = 57.0 bits (136), Expect = 5e-06 Identities = 31/46 (67%), Positives = 33/46 (71%) Frame = +1 Query: 337 IATRCKELGITALHIKLRAXXXXXXXXXXXXAQSALRALARSVLKI 474 +ATRCKELGITALHIKLRA AQSALRALARS +KI Sbjct: 80 VATRCKELGITALHIKLRATGGNKTKTPGPGAQSALRALARSGMKI 125 >dbj|BAJ93777.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 151 Score = 57.0 bits (136), Expect = 5e-06 Identities = 31/46 (67%), Positives = 33/46 (71%) Frame = +1 Query: 337 IATRCKELGITALHIKLRAXXXXXXXXXXXXAQSALRALARSVLKI 474 +ATRCKELGITALHIKLRA AQSALRALARS +KI Sbjct: 81 VATRCKELGITALHIKLRATGGNKTKTPGPGAQSALRALARSGMKI 126 >gb|ELA34976.1| 40s ribosomal protein s14 [Colletotrichum gloeosporioides Nara gc5] Length = 150 Score = 56.2 bits (134), Expect = 8e-06 Identities = 30/46 (65%), Positives = 33/46 (71%) Frame = +1 Query: 337 IATRCKELGITALHIKLRAXXXXXXXXXXXXAQSALRALARSVLKI 474 +ATRCKELGITALHIK+RA AQSALRALARS +KI Sbjct: 80 VATRCKELGITALHIKIRATGGNGTKTPGPGAQSALRALARSGMKI 125 >emb|CCF42567.1| 40S ribosomal protein S14 [Colletotrichum higginsianum] Length = 151 Score = 56.2 bits (134), Expect = 8e-06 Identities = 30/46 (65%), Positives = 33/46 (71%) Frame = +1 Query: 337 IATRCKELGITALHIKLRAXXXXXXXXXXXXAQSALRALARSVLKI 474 +ATRCKELGITALHIK+RA AQSALRALARS +KI Sbjct: 81 VATRCKELGITALHIKIRATGGNGTKTPGPGAQSALRALARSGMKI 126