BLASTX nr result
ID: Coptis25_contig00002447
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00002447 (207 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003539578.1| PREDICTED: probable disease resistance prote... 58 7e-07 ref|XP_002517593.1| Disease resistance protein RFL1, putative [R... 55 8e-06 ref|XP_002332019.1| BED finger-nbs-lrr resistance protein [Popul... 55 8e-06 >ref|XP_003539578.1| PREDICTED: probable disease resistance protein At4g27220-like [Glycine max] Length = 962 Score = 58.2 bits (139), Expect = 7e-07 Identities = 31/57 (54%), Positives = 37/57 (64%) Frame = +2 Query: 32 IIPKCPKLLTLILAHKQPAILQLEHVACGFFMHMKSLMVLDLSMTRIESLPDSASDL 202 I P+CPKL TLIL H + L ++ FF+HM SL VLDLS T IE LP S +DL Sbjct: 525 ISPRCPKLRTLILKHNE----SLTSISDSFFVHMSSLQVLDLSFTDIEVLPKSVADL 577 >ref|XP_002517593.1| Disease resistance protein RFL1, putative [Ricinus communis] gi|223543225|gb|EEF44757.1| Disease resistance protein RFL1, putative [Ricinus communis] Length = 881 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/66 (43%), Positives = 44/66 (66%) Frame = +2 Query: 8 ESGIENISIIPKCPKLLTLILAHKQPAILQLEHVACGFFMHMKSLMVLDLSMTRIESLPD 187 E+ I+++ IP CP LLTL L+ + P ++ ++ FF+ MKSL VLD+SMT I+ LP Sbjct: 518 ENSIQSLRKIPACPHLLTLFLS-RNPCLVM---ISGDFFLSMKSLTVLDMSMTSIQELPP 573 Query: 188 SASDLV 205 S+L+ Sbjct: 574 EISNLI 579 >ref|XP_002332019.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] gi|222875244|gb|EEF12375.1| BED finger-nbs-lrr resistance protein [Populus trichocarpa] Length = 909 Score = 54.7 bits (130), Expect = 8e-06 Identities = 36/69 (52%), Positives = 40/69 (57%), Gaps = 2/69 (2%) Frame = +2 Query: 5 MESGIENI--SIIPKCPKLLTLILAHKQPAILQLEHVACGFFMHMKSLMVLDLSMTRIES 178 ME+ IE I S P CP L TL L + L VA FF + LMVLDLS T IE+ Sbjct: 604 MENEIEEIPSSHSPMCPNLSTLFLCDNRG----LRFVADSFFKQLNGLMVLDLSRTGIEN 659 Query: 179 LPDSASDLV 205 LPDS SDLV Sbjct: 660 LPDSISDLV 668