BLASTX nr result
ID: Coptis25_contig00002440
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00002440 (1029 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003552950.1| PREDICTED: agglutinin-like [Glycine max] 80 8e-13 ref|XP_003539332.1| PREDICTED: myrosinase-binding protein-like A... 80 8e-13 ref|XP_002510452.1| pentatricopeptide repeat-containing protein,... 80 8e-13 ref|XP_003615697.1| Myrosinase-binding protein-like protein [Med... 79 2e-12 ref|XP_003544296.1| PREDICTED: pentatricopeptide repeat-containi... 76 1e-11 >ref|XP_003552950.1| PREDICTED: agglutinin-like [Glycine max] Length = 604 Score = 80.1 bits (196), Expect = 8e-13 Identities = 38/70 (54%), Positives = 50/70 (71%) Frame = -2 Query: 425 EASQKKPISVXXXXXXXXXXXXXGVYTTIRQLVIAHRAGIDSFQVEYDKKGSSIWSGKHG 246 ++ ++KP+SV GVY+T+RQLVI H GIDS Q+EYDK+GSSIWS K+G Sbjct: 16 QSFEEKPVSVGPWGGNGGYHWDDGVYSTVRQLVIVHGEGIDSIQIEYDKQGSSIWSLKYG 75 Query: 245 GSGGIKVDKL 216 GSGG K+DK+ Sbjct: 76 GSGGYKIDKI 85 >ref|XP_003539332.1| PREDICTED: myrosinase-binding protein-like At1g52040-like [Glycine max] Length = 594 Score = 80.1 bits (196), Expect = 8e-13 Identities = 38/70 (54%), Positives = 50/70 (71%) Frame = -2 Query: 425 EASQKKPISVXXXXXXXXXXXXXGVYTTIRQLVIAHRAGIDSFQVEYDKKGSSIWSGKHG 246 ++ ++KP+SV GVY+T+RQLVI H GIDS Q+EYDK+GSSIWS K+G Sbjct: 6 QSFEEKPVSVGPWGGNGGYRWDDGVYSTVRQLVIVHGEGIDSIQIEYDKQGSSIWSLKYG 65 Query: 245 GSGGIKVDKL 216 GSGG K+DK+ Sbjct: 66 GSGGYKIDKI 75 >ref|XP_002510452.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223551153|gb|EEF52639.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1218 Score = 80.1 bits (196), Expect = 8e-13 Identities = 38/67 (56%), Positives = 48/67 (71%) Frame = -2 Query: 416 QKKPISVXXXXXXXXXXXXXGVYTTIRQLVIAHRAGIDSFQVEYDKKGSSIWSGKHGGSG 237 +KKPI+V GVY+T+RQLVI H +GIDS Q+EYDKKG+SIWS KHGG+G Sbjct: 629 EKKPIAVGPWGGQNGCRWDDGVYSTVRQLVIVHGSGIDSIQIEYDKKGTSIWSEKHGGNG 688 Query: 236 GIKVDKL 216 G + DK+ Sbjct: 689 GNRTDKV 695 >ref|XP_003615697.1| Myrosinase-binding protein-like protein [Medicago truncatula] gi|355517032|gb|AES98655.1| Myrosinase-binding protein-like protein [Medicago truncatula] Length = 604 Score = 78.6 bits (192), Expect = 2e-12 Identities = 39/73 (53%), Positives = 48/73 (65%) Frame = -2 Query: 434 ESNEASQKKPISVXXXXXXXXXXXXXGVYTTIRQLVIAHRAGIDSFQVEYDKKGSSIWSG 255 +S+ S KKP SV G+Y+ +RQLV+ H GIDS Q+EYDKKGSSIWS Sbjct: 6 QSSVDSIKKPASVGPWGGNGGSRWDDGIYSGVRQLVVVHGTGIDSIQIEYDKKGSSIWSE 65 Query: 254 KHGGSGGIKVDKL 216 KHGG+GG K DK+ Sbjct: 66 KHGGTGGNKTDKV 78 >ref|XP_003544296.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like [Glycine max] Length = 945 Score = 76.3 bits (186), Expect = 1e-11 Identities = 40/72 (55%), Positives = 47/72 (65%) Frame = -2 Query: 431 SNEASQKKPISVXXXXXXXXXXXXXGVYTTIRQLVIAHRAGIDSFQVEYDKKGSSIWSGK 252 S E S KK SV G+Y+ +RQLV+ H AGIDS Q+EYDKKGSSIWS + Sbjct: 826 SFEDSTKKHQSVGPWGGNEGSRWDDGIYSGVRQLVMVHGAGIDSIQIEYDKKGSSIWSER 885 Query: 251 HGGSGGIKVDKL 216 HGGSGG K DK+ Sbjct: 886 HGGSGGRKTDKV 897