BLASTX nr result
ID: Coptis25_contig00002363
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00002363 (209 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN62110.1| hypothetical protein VITISV_038734 [Vitis vinifera] 55 8e-06 >emb|CAN62110.1| hypothetical protein VITISV_038734 [Vitis vinifera] Length = 1625 Score = 54.7 bits (130), Expect = 8e-06 Identities = 32/69 (46%), Positives = 44/69 (63%), Gaps = 2/69 (2%) Frame = -1 Query: 203 CGSLKSLSESSLQHLTALQKLDIWNCPELE-IMSVDFQHLISLQYLWLRWLPQLTSLPE- 30 C L+SL+E+ LQHLT+L+KL+I NCP L+ + V QHL SL+ L + L SL E Sbjct: 1249 CSRLQSLTEAGLQHLTSLEKLEIANCPMLQSLTKVGLQHLTSLKTLGINNCRMLQSLTEV 1308 Query: 29 EIQHARRLQ 3 +QH L+ Sbjct: 1309 GLQHLTSLE 1317 Score = 54.7 bits (130), Expect = 8e-06 Identities = 32/71 (45%), Positives = 44/71 (61%), Gaps = 2/71 (2%) Frame = -1 Query: 209 ANCGSLKSLSESSLQHLTALQKLDIWNCPELE-IMSVDFQHLISLQYLWLRWLPQLTSLP 33 ANC L+SL++ LQHLT+L+ L I NC L+ + V QHL SL+ LW+ P L SL Sbjct: 1272 ANCPMLQSLTKVGLQHLTSLKTLGINNCRMLQSLTEVGLQHLTSLESLWINNCPMLQSLT 1331 Query: 32 E-EIQHARRLQ 3 + +QH L+ Sbjct: 1332 KVGLQHLTSLE 1342 Score = 54.7 bits (130), Expect = 8e-06 Identities = 32/70 (45%), Positives = 43/70 (61%), Gaps = 2/70 (2%) Frame = -1 Query: 206 NCGSLKSLSESSLQHLTALQKLDIWNCPELE-IMSVDFQHLISLQYLWLRWLPQLTSLPE 30 NC L+SL+E LQHLT+L+ L I NCP L+ + V QHL SL+ LW+ L SL + Sbjct: 1298 NCRMLQSLTEVGLQHLTSLESLWINNCPMLQSLTKVGLQHLTSLESLWINKCXMLQSLTK 1357 Query: 29 -EIQHARRLQ 3 +QH L+ Sbjct: 1358 VGLQHLTSLK 1367