BLASTX nr result
ID: Coptis25_contig00002036
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00002036 (492 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG36943.1|AF274299_1 acid invertase [Brassica oleracea] 62 6e-08 gb|AAG36942.1|AF274298_1 acid invertase [Brassica oleracea] 62 6e-08 ref|XP_002888009.1| predicted protein [Arabidopsis lyrata subsp.... 62 6e-08 gb|AAK62665.1| At1g62660/F23N19_3 [Arabidopsis thaliana] gi|2330... 62 6e-08 emb|CAA64781.1| beta-fructosidase [Arabidopsis thaliana] 62 6e-08 >gb|AAG36943.1|AF274299_1 acid invertase [Brassica oleracea] Length = 662 Score = 61.6 bits (148), Expect = 6e-08 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = -3 Query: 301 GPLFYKGWYHFFLPVQPNAAVWGDIVCGHSYRK 203 GPLFYKGWYHFF PNAAVWGDIV GH+ K Sbjct: 136 GPLFYKGWYHFFYQYNPNAAVWGDIVWGHAVSK 168 >gb|AAG36942.1|AF274298_1 acid invertase [Brassica oleracea] Length = 663 Score = 61.6 bits (148), Expect = 6e-08 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = -3 Query: 301 GPLFYKGWYHFFLPVQPNAAVWGDIVCGHSYRK 203 GPLFYKGWYHFF PNAAVWGDIV GH+ K Sbjct: 137 GPLFYKGWYHFFYQYNPNAAVWGDIVWGHAVSK 169 >ref|XP_002888009.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297333850|gb|EFH64268.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 654 Score = 61.6 bits (148), Expect = 6e-08 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = -3 Query: 301 GPLFYKGWYHFFLPVQPNAAVWGDIVCGHSYRK 203 GPLFYKGWYHFF PNAAVWGDIV GH+ K Sbjct: 129 GPLFYKGWYHFFYQYNPNAAVWGDIVWGHAVSK 161 >gb|AAK62665.1| At1g62660/F23N19_3 [Arabidopsis thaliana] gi|23308217|gb|AAN18078.1| At1g62660/F23N19_3 [Arabidopsis thaliana] Length = 648 Score = 61.6 bits (148), Expect = 6e-08 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = -3 Query: 301 GPLFYKGWYHFFLPVQPNAAVWGDIVCGHSYRK 203 GPLFYKGWYHFF PNAAVWGDIV GH+ K Sbjct: 123 GPLFYKGWYHFFYQYNPNAAVWGDIVWGHAVSK 155 >emb|CAA64781.1| beta-fructosidase [Arabidopsis thaliana] Length = 639 Score = 61.6 bits (148), Expect = 6e-08 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = -3 Query: 301 GPLFYKGWYHFFLPVQPNAAVWGDIVCGHSYRK 203 GPLFYKGWYHFF PNAAVWGDIV GH+ K Sbjct: 114 GPLFYKGWYHFFYQYNPNAAVWGDIVWGHAVSK 146