BLASTX nr result
ID: Coptis25_contig00000872
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00000872 (243 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517369.1| ATP binding protein, putative [Ricinus commu... 70 2e-10 ref|XP_002300837.1| predicted protein [Populus trichocarpa] gi|2... 70 2e-10 ref|XP_004136629.1| PREDICTED: uncharacterized protein LOC101216... 69 5e-10 gb|AFK42112.1| unknown [Medicago truncatula] 69 5e-10 ref|XP_003578227.1| PREDICTED: uncharacterized protein LOC100845... 69 5e-10 >ref|XP_002517369.1| ATP binding protein, putative [Ricinus communis] gi|223543380|gb|EEF44911.1| ATP binding protein, putative [Ricinus communis] Length = 524 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 146 IVGPMPLPRAEGHISYGGALRPGEGDAIAQYV 241 +VGPMPLPRAEGHISYGGALRPGEGDAIAQYV Sbjct: 388 VVGPMPLPRAEGHISYGGALRPGEGDAIAQYV 419 >ref|XP_002300837.1| predicted protein [Populus trichocarpa] gi|222842563|gb|EEE80110.1| predicted protein [Populus trichocarpa] Length = 510 Score = 69.7 bits (169), Expect = 2e-10 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 146 IVGPMPLPRAEGHISYGGALRPGEGDAIAQYV 241 +VGPMPLPRAEGHISYGGALRPGEGDAIAQYV Sbjct: 374 VVGPMPLPRAEGHISYGGALRPGEGDAIAQYV 405 >ref|XP_004136629.1| PREDICTED: uncharacterized protein LOC101216782 [Cucumis sativus] gi|449517926|ref|XP_004165995.1| PREDICTED: uncharacterized protein LOC101231705 [Cucumis sativus] Length = 531 Score = 68.6 bits (166), Expect = 5e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 149 VGPMPLPRAEGHISYGGALRPGEGDAIAQYV 241 VGPMPLPRAEGHISYGGALRPGEGDAIAQYV Sbjct: 404 VGPMPLPRAEGHISYGGALRPGEGDAIAQYV 434 >gb|AFK42112.1| unknown [Medicago truncatula] Length = 486 Score = 68.6 bits (166), Expect = 5e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 149 VGPMPLPRAEGHISYGGALRPGEGDAIAQYV 241 VGPMPLPRAEGHISYGGALRPGEGDAIAQYV Sbjct: 354 VGPMPLPRAEGHISYGGALRPGEGDAIAQYV 384 >ref|XP_003578227.1| PREDICTED: uncharacterized protein LOC100845029 [Brachypodium distachyon] Length = 520 Score = 68.6 bits (166), Expect = 5e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +2 Query: 149 VGPMPLPRAEGHISYGGALRPGEGDAIAQYV 241 VGPMPLPRAEGHISYGGALRPGEGDAIAQYV Sbjct: 390 VGPMPLPRAEGHISYGGALRPGEGDAIAQYV 420