BLASTX nr result
ID: Coptis25_contig00000747
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00000747 (1364 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272288.2| PREDICTED: uncharacterized protein LOC100251... 103 8e-20 ref|XP_004171954.1| PREDICTED: uncharacterized LOC101217173 [Cuc... 99 3e-18 ref|XP_004134585.1| PREDICTED: uncharacterized protein LOC101217... 99 3e-18 gb|AEW69793.1| Hop-interacting protein THI030 [Solanum lycopersi... 94 8e-17 ref|XP_002531051.1| conserved hypothetical protein [Ricinus comm... 92 3e-16 >ref|XP_002272288.2| PREDICTED: uncharacterized protein LOC100251522 [Vitis vinifera] gi|297740769|emb|CBI30951.3| unnamed protein product [Vitis vinifera] Length = 512 Score = 103 bits (258), Expect = 8e-20 Identities = 50/67 (74%), Positives = 59/67 (88%) Frame = -2 Query: 631 DESEDSEVEGQDEAYEKLSRNWSVLKSTPELQKSKGKPKKECPMSLDDAIDDSENLTDFL 452 DE ED+EVEG DE EK++RNWSVLKSTP+L+KSK KPKKE PMS+++A+DDSENLTDFL Sbjct: 447 DEGEDTEVEGDDEE-EKITRNWSVLKSTPQLRKSKDKPKKEGPMSVEEAVDDSENLTDFL 505 Query: 451 LDVNEDE 431 LD EDE Sbjct: 506 LDFEEDE 512 >ref|XP_004171954.1| PREDICTED: uncharacterized LOC101217173 [Cucumis sativus] Length = 502 Score = 98.6 bits (244), Expect = 3e-18 Identities = 46/66 (69%), Positives = 55/66 (83%) Frame = -2 Query: 628 ESEDSEVEGQDEAYEKLSRNWSVLKSTPELQKSKGKPKKECPMSLDDAIDDSENLTDFLL 449 E++DSEVEG +EA EK++RNWSVLKS+P L K KGKP K+ P SLD AID+SENLTDFL+ Sbjct: 437 ENDDSEVEGDEEAEEKITRNWSVLKSSPHLSKQKGKPNKKDPASLDGAIDESENLTDFLM 496 Query: 448 DVNEDE 431 D EDE Sbjct: 497 DFEEDE 502 >ref|XP_004134585.1| PREDICTED: uncharacterized protein LOC101217173 [Cucumis sativus] Length = 527 Score = 98.6 bits (244), Expect = 3e-18 Identities = 46/66 (69%), Positives = 55/66 (83%) Frame = -2 Query: 628 ESEDSEVEGQDEAYEKLSRNWSVLKSTPELQKSKGKPKKECPMSLDDAIDDSENLTDFLL 449 E++DSEVEG +EA EK++RNWSVLKS+P L K KGKP K+ P SLD AID+SENLTDFL+ Sbjct: 462 ENDDSEVEGDEEAEEKITRNWSVLKSSPHLSKQKGKPNKKDPASLDGAIDESENLTDFLM 521 Query: 448 DVNEDE 431 D EDE Sbjct: 522 DFEEDE 527 >gb|AEW69793.1| Hop-interacting protein THI030 [Solanum lycopersicum] Length = 528 Score = 94.0 bits (232), Expect = 8e-17 Identities = 47/67 (70%), Positives = 57/67 (85%) Frame = -2 Query: 631 DESEDSEVEGQDEAYEKLSRNWSVLKSTPELQKSKGKPKKECPMSLDDAIDDSENLTDFL 452 DE E SE EG++E EK++RNWSVLKS PEL KSKGKPKK+ MSL++A+DDSENLTDFL Sbjct: 464 DEEEGSEAEGEEED-EKITRNWSVLKSNPELSKSKGKPKKK-DMSLEEAVDDSENLTDFL 521 Query: 451 LDVNEDE 431 +D +EDE Sbjct: 522 MDFDEDE 528 >ref|XP_002531051.1| conserved hypothetical protein [Ricinus communis] gi|223529346|gb|EEF31312.1| conserved hypothetical protein [Ricinus communis] Length = 524 Score = 92.0 bits (227), Expect = 3e-16 Identities = 42/67 (62%), Positives = 57/67 (85%) Frame = -2 Query: 631 DESEDSEVEGQDEAYEKLSRNWSVLKSTPELQKSKGKPKKECPMSLDDAIDDSENLTDFL 452 ++S+D E E ++E EK++RNWSVLKSTP+L+KSK KPKK+ MSL++AI+DSENLTDFL Sbjct: 457 EDSDDEEEEEEEEEEEKVTRNWSVLKSTPQLRKSKAKPKKDGGMSLEEAIEDSENLTDFL 516 Query: 451 LDVNEDE 431 +D E+E Sbjct: 517 MDFGEEE 523