BLASTX nr result
ID: Coptis25_contig00000682
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00000682 (331 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521818.1| conserved hypothetical protein [Ricinus comm... 68 9e-10 ref|XP_002527491.1| conserved hypothetical protein [Ricinus comm... 67 2e-09 ref|XP_002527490.1| conserved hypothetical protein [Ricinus comm... 65 7e-09 ref|XP_002527500.1| conserved hypothetical protein [Ricinus comm... 55 5e-06 >ref|XP_002521818.1| conserved hypothetical protein [Ricinus communis] gi|223539031|gb|EEF40628.1| conserved hypothetical protein [Ricinus communis] Length = 78 Score = 67.8 bits (164), Expect = 9e-10 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = -1 Query: 223 LPVPS*ELVFVGLAKAWSTWFLEWRVLRQSGFTEQRKPPALDSGRIT 83 LP PS EL FV LAK +T LEWRVLR++GFTEQR PPALDSG IT Sbjct: 11 LPAPSGELSFVVLAKVGTTLLLEWRVLREAGFTEQRSPPALDSGWIT 57 >ref|XP_002527491.1| conserved hypothetical protein [Ricinus communis] gi|223533131|gb|EEF34889.1| conserved hypothetical protein [Ricinus communis] Length = 101 Score = 66.6 bits (161), Expect = 2e-09 Identities = 44/91 (48%), Positives = 51/91 (56%), Gaps = 5/91 (5%) Frame = +3 Query: 66 LWSNRLVILPLSRAGGFRCSVKPD*RSTLHSRNHVDQAFAKPTKTNS*LGTGKSVCSYHR 245 L ++LVILPL RAGG RCSVKP R L SRN V AFA+ G++ H+ Sbjct: 14 LGRHQLVILPLPRAGGCRCSVKPASRCALRSRNQVTPAFAQGHIAQLSAWNGRARAQPHQ 73 Query: 246 -----PDQEP*GLCSITLMPSLELQAHAT*P 323 P+Q P ITLMP L LQAHAT P Sbjct: 74 GRPTGPEQRP-----ITLMPLLRLQAHATEP 99 >ref|XP_002527490.1| conserved hypothetical protein [Ricinus communis] gi|223533130|gb|EEF34888.1| conserved hypothetical protein [Ricinus communis] Length = 60 Score = 64.7 bits (156), Expect = 7e-09 Identities = 33/51 (64%), Positives = 35/51 (68%) Frame = -3 Query: 221 ARSKLRVGLCGFGEGLVHVVPRVEGTASVWFHRAAKTSRSRQWEDNESVAP 69 ARSKLRV CG GEG + PR EGTA WFHRAA TS S QW+DN V P Sbjct: 5 ARSKLRVDPCGLGEGPGSMGPRAEGTALGWFHRAAITSLSWQWKDNGPVLP 55 >ref|XP_002527500.1| conserved hypothetical protein [Ricinus communis] gi|223533140|gb|EEF34898.1| conserved hypothetical protein [Ricinus communis] Length = 61 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = -1 Query: 220 PVPS*ELVFVGLAKAWSTWFLEWRVLRQSGFTEQRKPPALD 98 PVPS EL V AKAW++ FLEWR R++GFTE++KPP+L+ Sbjct: 12 PVPSWELNRVARAKAWASLFLEWREPREAGFTEEQKPPSLE 52