BLASTX nr result
ID: Coptis25_contig00000636
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00000636 (449 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525233.1| Pectinesterase inhibitor, putative [Ricinus ... 59 4e-07 >ref|XP_002525233.1| Pectinesterase inhibitor, putative [Ricinus communis] gi|223535530|gb|EEF37199.1| Pectinesterase inhibitor, putative [Ricinus communis] Length = 175 Score = 58.9 bits (141), Expect = 4e-07 Identities = 42/127 (33%), Positives = 66/127 (51%), Gaps = 1/127 (0%) Frame = +3 Query: 3 DADKFLLAPIVFRAAYDRVSTTRAHIT-LLRNDTILRKDKHIIKALLHCRSNYRQADKTI 179 DAD++ LA I AY ++TR HI+ LL+N H + L C NY +A + Sbjct: 55 DADEYTLAFISVGLAYANATSTRDHISELLKNH-----HDHYQQPLQRCVRNYNKAISLL 109 Query: 180 LGAFDFIDSEYYSDLKDFVPRLARSAVDCESGFSKIGKASPMTMMNKFLKDLTDIITVVC 359 A + ++SE + +L D + +R+A DC++ F I + P+ N LK L I ++ Sbjct: 110 AMADNDLNSETFFELADLANQASRAATDCDAAFKGI-PSPPLANRNSDLKALCQICGILG 168 Query: 360 KLYN*LL 380 KL+ LL Sbjct: 169 KLFTGLL 175