BLASTX nr result
ID: Coptis24_contig00039809
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00039809 (245 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531699.1| conserved hypothetical protein [Ricinus comm... 78 6e-13 ref|XP_004149424.1| PREDICTED: uncharacterized protein LOC101220... 77 2e-12 ref|XP_003617957.1| hypothetical protein MTR_5g097370 [Medicago ... 75 4e-12 ref|XP_004144615.1| PREDICTED: uncharacterized protein LOC101210... 69 4e-10 ref|XP_002520030.1| conserved hypothetical protein [Ricinus comm... 65 7e-09 >ref|XP_002531699.1| conserved hypothetical protein [Ricinus communis] gi|223528675|gb|EEF30690.1| conserved hypothetical protein [Ricinus communis] Length = 204 Score = 78.2 bits (191), Expect = 6e-13 Identities = 37/78 (47%), Positives = 56/78 (71%) Frame = -2 Query: 244 LNSDRNSLKDHGQLTFLMPDDAQLSSSAISREQLREFLLSHSLPTALPLNNLIHLPTGTI 65 LN NSL+D G++TFLMP D +LS A+ E L++F+L HS+PTAL +++L+H P GT+ Sbjct: 56 LNGSPNSLRD-GEITFLMPSDEELSKVALRLESLQDFILGHSIPTALLISHLLHFPNGTL 114 Query: 64 MPSSFAANKTITITNHGR 11 +P+ N+ + +TN GR Sbjct: 115 VPTG-VPNRMLRVTNGGR 131 >ref|XP_004149424.1| PREDICTED: uncharacterized protein LOC101220860 [Cucumis sativus] gi|449496897|ref|XP_004160256.1| PREDICTED: uncharacterized LOC101220860 [Cucumis sativus] Length = 197 Score = 76.6 bits (187), Expect = 2e-12 Identities = 40/75 (53%), Positives = 54/75 (72%) Frame = -2 Query: 244 LNSDRNSLKDHGQLTFLMPDDAQLSSSAISREQLREFLLSHSLPTALPLNNLIHLPTGTI 65 LNS +L++ +TF MP D +LS + IS ++L EF+LSHS+PTAL LNNL+H P GT+ Sbjct: 47 LNSTTKTLQN-SNITFFMPTDQELSQADISPDRLEEFVLSHSIPTALLLNNLLHFPNGTL 105 Query: 64 MPSSFAANKTITITN 20 +PSS N+ I ITN Sbjct: 106 VPSSI-PNRMIRITN 119 >ref|XP_003617957.1| hypothetical protein MTR_5g097370 [Medicago truncatula] gi|355519292|gb|AET00916.1| hypothetical protein MTR_5g097370 [Medicago truncatula] Length = 193 Score = 75.5 bits (184), Expect = 4e-12 Identities = 40/78 (51%), Positives = 57/78 (73%) Frame = -2 Query: 244 LNSDRNSLKDHGQLTFLMPDDAQLSSSAISREQLREFLLSHSLPTALPLNNLIHLPTGTI 65 LNS N ++++ LTFLMP+D LS +I+ E+L +FLLSHS+PT L LN+L+H P G+I Sbjct: 51 LNSLPNQMQNN-DLTFLMPNDEDLSHFSIAPEELHDFLLSHSIPTPLLLNHLLHFPNGSI 109 Query: 64 MPSSFAANKTITITNHGR 11 +PS +K I+ITN+ R Sbjct: 110 VPSGL-PSKVISITNNAR 126 >ref|XP_004144615.1| PREDICTED: uncharacterized protein LOC101210447 [Cucumis sativus] gi|449511819|ref|XP_004164062.1| PREDICTED: uncharacterized protein LOC101229762 [Cucumis sativus] Length = 192 Score = 68.9 bits (167), Expect = 4e-10 Identities = 36/74 (48%), Positives = 50/74 (67%) Frame = -2 Query: 244 LNSDRNSLKDHGQLTFLMPDDAQLSSSAISREQLREFLLSHSLPTALPLNNLIHLPTGTI 65 LN+ +L++ +TF MP D +LS + IS +QL EF+L HS+PT L LNNL H P G++ Sbjct: 42 LNNSNKTLQN-SDITFFMPTDQELSQADISLDQLEEFVLRHSIPTTLLLNNLSHFPNGSL 100 Query: 64 MPSSFAANKTITIT 23 +PSS N+ I IT Sbjct: 101 VPSSI-PNRMIKIT 113 >ref|XP_002520030.1| conserved hypothetical protein [Ricinus communis] gi|223540794|gb|EEF42354.1| conserved hypothetical protein [Ricinus communis] Length = 245 Score = 64.7 bits (156), Expect = 7e-09 Identities = 33/70 (47%), Positives = 48/70 (68%) Frame = -2 Query: 211 GQLTFLMPDDAQLSSSAISREQLREFLLSHSLPTALPLNNLIHLPTGTIMPSSFAANKTI 32 G +TFLMP+D LS S I ++ L +FLL HS+P+ L ++L H+P+G+ +PSS + + Sbjct: 62 GNITFLMPNDRILSKSRIPQKSLADFLLHHSIPSPLLFDHLQHIPSGSTIPSS-DPDYML 120 Query: 31 TITNHGRLNF 2 ITN GR NF Sbjct: 121 DITNKGRRNF 130