BLASTX nr result
ID: Coptis24_contig00039663
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00039663 (272 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524706.1| cyclin d, putative [Ricinus communis] gi|223... 60 2e-07 ref|XP_002305644.1| predicted protein [Populus trichocarpa] gi|1... 57 2e-06 ref|XP_002316670.1| predicted protein [Populus trichocarpa] gi|1... 55 8e-06 >ref|XP_002524706.1| cyclin d, putative [Ricinus communis] gi|223536067|gb|EEF37725.1| cyclin d, putative [Ricinus communis] Length = 305 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = -3 Query: 171 MEFDLENPLTGIVEHQPDTIPSLFTSELDHMPCKDF 64 MEFDLENPLT EHQ DTIP LF SE DHMP +DF Sbjct: 1 MEFDLENPLTSSNEHQSDTIPDLFASESDHMPSRDF 36 >ref|XP_002305644.1| predicted protein [Populus trichocarpa] gi|159025731|emb|CAN88866.1| D6-type cyclin [Populus trichocarpa] gi|222848608|gb|EEE86155.1| predicted protein [Populus trichocarpa] Length = 305 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -3 Query: 171 MEFDLENPLTGIVEHQPDTIPSLFTSELDHMPCKDF 64 MEFDLEN LT + EHQ DT+P+LF SE DHMP ++F Sbjct: 1 MEFDLENSLTSLEEHQSDTVPNLFASESDHMPSRNF 36 >ref|XP_002316670.1| predicted protein [Populus trichocarpa] gi|159025733|emb|CAN88867.1| D6-type cyclin [Populus trichocarpa] gi|222859735|gb|EEE97282.1| predicted protein [Populus trichocarpa] Length = 309 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -3 Query: 171 MEFDLENPLTGIVEHQPDTIPSLFTSELDHMPCKDF 64 MEFDLENPLT + E+ DTIP LF SE DHMP ++F Sbjct: 1 MEFDLENPLTSLKEYVSDTIPDLFVSESDHMPSRNF 36