BLASTX nr result
ID: Coptis24_contig00039060
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00039060 (370 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002873035.1| mitochondrial glycoprotein family protein [A... 59 4e-07 ref|XP_002529868.1| Mitochondrial acidic protein MAM33, mitochon... 59 5e-07 ref|NP_195825.1| Mitochondrial glycoprotein family protein [Arab... 59 5e-07 gb|AAM64272.1| unknown [Arabidopsis thaliana] 57 1e-06 ref|XP_004138451.1| PREDICTED: uncharacterized protein At2g39795... 55 5e-06 >ref|XP_002873035.1| mitochondrial glycoprotein family protein [Arabidopsis lyrata subsp. lyrata] gi|297318872|gb|EFH49294.1| mitochondrial glycoprotein family protein [Arabidopsis lyrata subsp. lyrata] Length = 264 Score = 58.9 bits (141), Expect = 4e-07 Identities = 31/78 (39%), Positives = 49/78 (62%) Frame = +2 Query: 23 IKTLHLKEDSPHSSSNLDACDRQLFSEWEEDLQKVFYEFLDMRGINTSLMSFLQNYMRSN 202 I +L +K+ P S N A + F + +E+LQK F+ +L++RGI S +FL +Y+ + Sbjct: 189 IDSLSIKQ--PQESENELAYEGPDFDDLDENLQKAFHRYLEIRGIKPSFTTFLADYVANK 246 Query: 203 YKRDKVTWLKILKAFVEK 256 R+ + WLK LK+FVEK Sbjct: 247 DSREYLQWLKDLKSFVEK 264 >ref|XP_002529868.1| Mitochondrial acidic protein MAM33, mitochondrial precursor, putative [Ricinus communis] gi|223530644|gb|EEF32518.1| Mitochondrial acidic protein MAM33, mitochondrial precursor, putative [Ricinus communis] Length = 174 Score = 58.5 bits (140), Expect = 5e-07 Identities = 31/78 (39%), Positives = 51/78 (65%) Frame = +2 Query: 23 IKTLHLKEDSPHSSSNLDACDRQLFSEWEEDLQKVFYEFLDMRGINTSLMSFLQNYMRSN 202 I TL ++ +P SS + A + F + +E+LQK F+++L++RGI S +FL +YM + Sbjct: 99 IDTLSIR--NPDSSEDQLAYEGPDFGDLDENLQKAFHKYLEIRGIKPSTTNFLFDYMENK 156 Query: 203 YKRDKVTWLKILKAFVEK 256 ++ + WLK LK+FVEK Sbjct: 157 DNKEYLLWLKNLKSFVEK 174 >ref|NP_195825.1| Mitochondrial glycoprotein family protein [Arabidopsis thaliana] gi|7340679|emb|CAB82978.1| putative protein [Arabidopsis thaliana] gi|32815955|gb|AAP88362.1| At5g02050 [Arabidopsis thaliana] gi|110735920|dbj|BAE99935.1| hypothetical protein [Arabidopsis thaliana] gi|332003043|gb|AED90426.1| Mitochondrial glycoprotein family protein [Arabidopsis thaliana] Length = 267 Score = 58.5 bits (140), Expect = 5e-07 Identities = 31/78 (39%), Positives = 49/78 (62%) Frame = +2 Query: 23 IKTLHLKEDSPHSSSNLDACDRQLFSEWEEDLQKVFYEFLDMRGINTSLMSFLQNYMRSN 202 I +L +K+ P S N A + F + +E+LQK F+ +L++RGI S +FL +Y+ + Sbjct: 192 IDSLSIKQ--PQGSDNDLAYEGPDFDDLDENLQKAFHRYLEIRGIKPSFTTFLADYVANK 249 Query: 203 YKRDKVTWLKILKAFVEK 256 R+ + WLK LK+FVEK Sbjct: 250 DSREYLQWLKDLKSFVEK 267 >gb|AAM64272.1| unknown [Arabidopsis thaliana] Length = 267 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/68 (41%), Positives = 43/68 (63%) Frame = +2 Query: 53 PHSSSNLDACDRQLFSEWEEDLQKVFYEFLDMRGINTSLMSFLQNYMRSNYKRDKVTWLK 232 P S N A + F + +E+LQK F+ +L++RGI S +FL +Y+ + R+ + WLK Sbjct: 200 PQGSDNDLAYEGPDFDDLDENLQKAFHRYLEIRGIKPSFTTFLADYVANKDSREYLQWLK 259 Query: 233 ILKAFVEK 256 LK+FVEK Sbjct: 260 DLKSFVEK 267 >ref|XP_004138451.1| PREDICTED: uncharacterized protein At2g39795, mitochondrial-like [Cucumis sativus] gi|449495281|ref|XP_004159787.1| PREDICTED: uncharacterized protein At2g39795, mitochondrial-like [Cucumis sativus] Length = 253 Score = 55.5 bits (132), Expect = 5e-06 Identities = 30/78 (38%), Positives = 46/78 (58%) Frame = +2 Query: 20 EIKTLHLKEDSPHSSSNLDACDRQLFSEWEEDLQKVFYEFLDMRGINTSLMSFLQNYMRS 199 EI L +P S + A + F + +E+LQK F+++L++RGI S +FL YM + Sbjct: 175 EISIDSLIVKNPEHSDDQIAYEGPDFHDLDENLQKAFHKYLEIRGIKPSTTNFLHEYMIN 234 Query: 200 NYKRDKVTWLKILKAFVE 253 R+ +TWL LK+FVE Sbjct: 235 KDSREYLTWLTKLKSFVE 252