BLASTX nr result
ID: Coptis24_contig00038912
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00038912 (353 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316376.1| predicted protein [Populus trichocarpa] gi|2... 96 2e-18 gb|ABR18180.1| unknown [Picea sitchensis] 93 2e-17 ref|XP_002534553.1| calcium lipid binding protein, putative [Ric... 93 3e-17 ref|XP_002276374.2| PREDICTED: extended synaptotagmin-2-like [Vi... 92 4e-17 emb|CBI32744.3| unnamed protein product [Vitis vinifera] 92 4e-17 >ref|XP_002316376.1| predicted protein [Populus trichocarpa] gi|222865416|gb|EEF02547.1| predicted protein [Populus trichocarpa] Length = 544 Score = 96.3 bits (238), Expect = 2e-18 Identities = 37/56 (66%), Positives = 51/56 (91%) Frame = -1 Query: 170 QPRDVEDPIVRPLHELDSDTIRDLLPEVPLWVKYSDYDRVDWLSRFVSDMWPYLNK 3 +P+DV+DP+VRPLHELD+D + D+LP++PLWVK DY+RVDWL++F+ DMWPYL+K Sbjct: 32 KPKDVKDPVVRPLHELDTDALLDILPDIPLWVKCPDYERVDWLNKFLLDMWPYLDK 87 >gb|ABR18180.1| unknown [Picea sitchensis] Length = 536 Score = 93.2 bits (230), Expect = 2e-17 Identities = 39/56 (69%), Positives = 47/56 (83%) Frame = -1 Query: 170 QPRDVEDPIVRPLHELDSDTIRDLLPEVPLWVKYSDYDRVDWLSRFVSDMWPYLNK 3 QP DV+DPI+RPL ELDS T+ LLPE+PLWVK DYDRVDWL+ F+ +MWPYL+K Sbjct: 32 QPTDVKDPIIRPLGELDSKTLEGLLPEIPLWVKNPDYDRVDWLNTFIHEMWPYLDK 87 >ref|XP_002534553.1| calcium lipid binding protein, putative [Ricinus communis] gi|223525050|gb|EEF27829.1| calcium lipid binding protein, putative [Ricinus communis] Length = 541 Score = 92.8 bits (229), Expect = 3e-17 Identities = 37/53 (69%), Positives = 47/53 (88%) Frame = -1 Query: 161 DVEDPIVRPLHELDSDTIRDLLPEVPLWVKYSDYDRVDWLSRFVSDMWPYLNK 3 DV+DP+VRPLHELDS T+ D+LPE+PLWVK DY+RVDWL++ + DMWPYL+K Sbjct: 37 DVKDPVVRPLHELDSSTLEDILPEIPLWVKCPDYERVDWLNKLLLDMWPYLDK 89 >ref|XP_002276374.2| PREDICTED: extended synaptotagmin-2-like [Vitis vinifera] Length = 546 Score = 92.0 bits (227), Expect = 4e-17 Identities = 37/56 (66%), Positives = 49/56 (87%) Frame = -1 Query: 170 QPRDVEDPIVRPLHELDSDTIRDLLPEVPLWVKYSDYDRVDWLSRFVSDMWPYLNK 3 +P+DV+ PI+RPLH+LDSD++ DLL E+PLWVK DYDR DWL++F+ DMWPYL+K Sbjct: 32 EPQDVKVPIIRPLHDLDSDSLLDLLDEMPLWVKTPDYDRADWLNKFIFDMWPYLDK 87 >emb|CBI32744.3| unnamed protein product [Vitis vinifera] Length = 547 Score = 92.0 bits (227), Expect = 4e-17 Identities = 37/56 (66%), Positives = 49/56 (87%) Frame = -1 Query: 170 QPRDVEDPIVRPLHELDSDTIRDLLPEVPLWVKYSDYDRVDWLSRFVSDMWPYLNK 3 +P+DV+ PI+RPLH+LDSD++ DLL E+PLWVK DYDR DWL++F+ DMWPYL+K Sbjct: 32 EPQDVKVPIIRPLHDLDSDSLLDLLDEMPLWVKTPDYDRADWLNKFIFDMWPYLDK 87