BLASTX nr result
ID: Coptis24_contig00038740
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00038740 (240 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002330363.1| predicted protein [Populus trichocarpa] gi|2... 78 7e-13 ref|XP_004165782.1| PREDICTED: pentatricopeptide repeat-containi... 74 9e-12 ref|XP_004143199.1| PREDICTED: pentatricopeptide repeat-containi... 74 9e-12 emb|CBI26082.3| unnamed protein product [Vitis vinifera] 72 4e-11 ref|XP_002276230.1| PREDICTED: pentatricopeptide repeat-containi... 72 4e-11 >ref|XP_002330363.1| predicted protein [Populus trichocarpa] gi|222871567|gb|EEF08698.1| predicted protein [Populus trichocarpa] Length = 584 Score = 78.2 bits (191), Expect = 7e-13 Identities = 35/50 (70%), Positives = 41/50 (82%) Frame = +1 Query: 88 KSGFLNHTITANHLLNAYVRLENIKDAQNLFDEMHDPNVVSWTSLMSGYI 237 K G LN TIT NHLLN+Y+R I+ A +LFDEMH+PNVVSWTSLMSGY+ Sbjct: 34 KFGLLNDTITTNHLLNSYLRFRRIQYAHHLFDEMHEPNVVSWTSLMSGYV 83 >ref|XP_004165782.1| PREDICTED: pentatricopeptide repeat-containing protein At4g15720-like [Cucumis sativus] Length = 603 Score = 74.3 bits (181), Expect = 9e-12 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = +1 Query: 82 SVKSGFLNHTITANHLLNAYVRLENIKDAQNLFDEMHDPNVVSWTSLMSGYI 237 ++K GFLN+T+ NHL+N YVR +I A LFDEM +PNVVSWTSLM+GY+ Sbjct: 50 ALKLGFLNNTVNVNHLINCYVRFRSIATAHQLFDEMPNPNVVSWTSLMAGYV 101 >ref|XP_004143199.1| PREDICTED: pentatricopeptide repeat-containing protein At4g15720-like [Cucumis sativus] Length = 603 Score = 74.3 bits (181), Expect = 9e-12 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = +1 Query: 82 SVKSGFLNHTITANHLLNAYVRLENIKDAQNLFDEMHDPNVVSWTSLMSGYI 237 ++K GFLN+T+ NHL+N YVR +I A LFDEM +PNVVSWTSLM+GY+ Sbjct: 50 ALKLGFLNNTVNVNHLINCYVRFRSIATAHQLFDEMPNPNVVSWTSLMAGYV 101 >emb|CBI26082.3| unnamed protein product [Vitis vinifera] Length = 568 Score = 72.4 bits (176), Expect = 4e-11 Identities = 31/51 (60%), Positives = 41/51 (80%) Frame = +1 Query: 85 VKSGFLNHTITANHLLNAYVRLENIKDAQNLFDEMHDPNVVSWTSLMSGYI 237 +KSGFLN T T NHL+N+YVR+ DA LF+EM +PNV+S+TSLM+G+I Sbjct: 54 LKSGFLNDTFTTNHLINSYVRIRRTNDASQLFEEMREPNVISFTSLMAGFI 104 >ref|XP_002276230.1| PREDICTED: pentatricopeptide repeat-containing protein At4g15720-like [Vitis vinifera] Length = 606 Score = 72.4 bits (176), Expect = 4e-11 Identities = 31/51 (60%), Positives = 41/51 (80%) Frame = +1 Query: 85 VKSGFLNHTITANHLLNAYVRLENIKDAQNLFDEMHDPNVVSWTSLMSGYI 237 +KSGFLN T T NHL+N+YVR+ DA LF+EM +PNV+S+TSLM+G+I Sbjct: 54 LKSGFLNDTFTTNHLINSYVRIRRTNDASQLFEEMREPNVISFTSLMAGFI 104