BLASTX nr result
ID: Coptis24_contig00038408
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00038408 (245 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513006.1| aldo-keto reductase, putative [Ricinus commu... 57 2e-06 ref|XP_004148544.1| PREDICTED: NADP-dependent D-sorbitol-6-phosp... 55 4e-06 ref|XP_003607080.1| NADP-dependent D-sorbitol-6-phosphate dehydr... 55 4e-06 gb|AAG15839.2|AF055910_1 NADPH-dependent mannose 6-phosphate red... 55 8e-06 >ref|XP_002513006.1| aldo-keto reductase, putative [Ricinus communis] gi|223548017|gb|EEF49509.1| aldo-keto reductase, putative [Ricinus communis] Length = 309 Score = 56.6 bits (135), Expect = 2e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -1 Query: 245 IGLGVWRVEDKSVKDLLLNAIKIGYCHFDCA 153 IGLGVWR+E K ++DL++NAIKIGY HFDCA Sbjct: 14 IGLGVWRMEGKDIRDLIINAIKIGYRHFDCA 44 >ref|XP_004148544.1| PREDICTED: NADP-dependent D-sorbitol-6-phosphate dehydrogenase-like [Cucumis sativus] gi|449521003|ref|XP_004167521.1| PREDICTED: NADP-dependent D-sorbitol-6-phosphate dehydrogenase-like [Cucumis sativus] Length = 309 Score = 55.5 bits (132), Expect = 4e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -1 Query: 245 IGLGVWRVEDKSVKDLLLNAIKIGYCHFDCA 153 IGLGVWR+E + V+DL++NAIKIGY HFDCA Sbjct: 14 IGLGVWRMEKQQVRDLIINAIKIGYRHFDCA 44 >ref|XP_003607080.1| NADP-dependent D-sorbitol-6-phosphate dehydrogenase [Medicago truncatula] gi|355508135|gb|AES89277.1| NADP-dependent D-sorbitol-6-phosphate dehydrogenase [Medicago truncatula] gi|388507144|gb|AFK41638.1| unknown [Medicago truncatula] Length = 309 Score = 55.5 bits (132), Expect = 4e-06 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = -1 Query: 245 IGLGVWRVEDKSVKDLLLNAIKIGYCHFDCA 153 IGLGVWR+E +++KDL++N+IKIGY HFDCA Sbjct: 14 IGLGVWRMEGQAIKDLIINSIKIGYRHFDCA 44 >gb|AAG15839.2|AF055910_1 NADPH-dependent mannose 6-phosphate reductase [Orobanche ramosa] Length = 310 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -1 Query: 245 IGLGVWRVEDKSVKDLLLNAIKIGYCHFDCA 153 IGLGVWR E K +K+L++NAIKIGY HFDCA Sbjct: 14 IGLGVWRTEGKDLKNLIINAIKIGYRHFDCA 44