BLASTX nr result
ID: Coptis24_contig00038002
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00038002 (418 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB86676.1| putative protein [Arabidopsis thaliana] 54 1e-05 >emb|CAB86676.1| putative protein [Arabidopsis thaliana] Length = 534 Score = 54.3 bits (129), Expect = 1e-05 Identities = 22/51 (43%), Positives = 33/51 (64%) Frame = -1 Query: 370 YPNKIPSLSFISWLALRDGLKTLQRLKQWNFIASDVCVLCNRGVETEEHLF 218 +PN P SFI+W+A R+ L T ++L +WN A+ C C+ +ET EH+F Sbjct: 110 FPNSTPKYSFITWIAFRNRLATGEKLVKWNNDANGGCSFCDEAMETREHIF 160