BLASTX nr result
ID: Coptis24_contig00037468
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00037468 (279 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003533355.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 gb|AFW67143.1| hypothetical protein ZEAMMB73_912965 [Zea mays] 55 6e-06 ref|NP_001145890.1| uncharacterized protein LOC100279406 [Zea ma... 55 6e-06 >ref|XP_003533355.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Glycine max] Length = 540 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/54 (50%), Positives = 37/54 (68%) Frame = -3 Query: 277 IRASMDKRGIKKSVPGCSMIEVDGIVHEFSVQGSPEAKMKEVEWILTSISGEIK 116 IR M ++ I+K +PGCSMIE++G V EFS GS E MKE+ +L +S E+K Sbjct: 486 IRNIMKEKRIEKKIPGCSMIEINGEVQEFSAGGSSELPMKELVLVLNGLSNEMK 539 >gb|AFW67143.1| hypothetical protein ZEAMMB73_912965 [Zea mays] Length = 619 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/68 (41%), Positives = 42/68 (61%) Frame = -3 Query: 277 IRASMDKRGIKKSVPGCSMIEVDGIVHEFSVQGSPEAKMKEVEWILTSISGEIKRGGDTL 98 IR M KRGIKK VPGCS++E+DG VHEF + KE+ ++ ++ E++R G Sbjct: 472 IRREMSKRGIKK-VPGCSLVELDGEVHEFIAGDESHPQWKEIYMMVEEMARELRRAGHIS 530 Query: 97 SGNLELID 74 + + L+D Sbjct: 531 ATSEVLLD 538 >ref|NP_001145890.1| uncharacterized protein LOC100279406 [Zea mays] gi|219884839|gb|ACL52794.1| unknown [Zea mays] Length = 318 Score = 55.1 bits (131), Expect = 6e-06 Identities = 28/68 (41%), Positives = 42/68 (61%) Frame = -3 Query: 277 IRASMDKRGIKKSVPGCSMIEVDGIVHEFSVQGSPEAKMKEVEWILTSISGEIKRGGDTL 98 IR M KRGIKK VPGCS++E+DG VHEF + KE+ ++ ++ E++R G Sbjct: 171 IRREMSKRGIKK-VPGCSLVELDGEVHEFIAGDESHPQWKEIYMMVEEMARELRRAGHIS 229 Query: 97 SGNLELID 74 + + L+D Sbjct: 230 ATSEVLLD 237