BLASTX nr result
ID: Coptis24_contig00037444
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00037444 (309 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004145372.1| PREDICTED: histone H2A variant 1-like isofor... 55 8e-06 >ref|XP_004145372.1| PREDICTED: histone H2A variant 1-like isoform 1 [Cucumis sativus] gi|449455264|ref|XP_004145373.1| PREDICTED: histone H2A variant 1-like isoform 2 [Cucumis sativus] gi|449470505|ref|XP_004152957.1| PREDICTED: histone H2A variant 1-like isoform 1 [Cucumis sativus] gi|449470507|ref|XP_004152958.1| PREDICTED: histone H2A variant 1-like isoform 2 [Cucumis sativus] gi|449509347|ref|XP_004163562.1| PREDICTED: histone H2A variant 1-like isoform 1 [Cucumis sativus] gi|449509351|ref|XP_004163563.1| PREDICTED: histone H2A variant 1-like isoform 2 [Cucumis sativus] Length = 136 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = -1 Query: 99 SRAGFQFPVGCIHRHLKSRIGANGRVEPTAVVY 1 SRAG QFPVG IHRHLK+RI ANGRV TA VY Sbjct: 33 SRAGIQFPVGRIHRHLKTRISANGRVGATAAVY 65