BLASTX nr result
ID: Coptis24_contig00037316
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00037316 (339 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002326185.1| EIN2 -like protein, nramp transporter [Popul... 60 2e-07 ref|XP_002322882.1| EIN2 -like protein, nramp transporter [Popul... 56 3e-06 ref|XP_002519522.1| ethylene insensitive protein, putative [Rici... 55 6e-06 >ref|XP_002326185.1| EIN2 -like protein, nramp transporter [Populus trichocarpa] gi|222833378|gb|EEE71855.1| EIN2 -like protein, nramp transporter [Populus trichocarpa] Length = 1310 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/40 (65%), Positives = 35/40 (87%) Frame = -1 Query: 123 FFAVLCFFSGIFLVKYVVMSSAASIFYSAGLVVLSF*DIL 4 FFA+LC FSGI+LV YV+M+SAA++FYS GLV+L+F D + Sbjct: 238 FFAILCIFSGIYLVNYVLMNSAANVFYSTGLVLLTFPDAM 277 >ref|XP_002322882.1| EIN2 -like protein, nramp transporter [Populus trichocarpa] gi|222867512|gb|EEF04643.1| EIN2 -like protein, nramp transporter [Populus trichocarpa] Length = 1259 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/40 (60%), Positives = 35/40 (87%) Frame = -1 Query: 123 FFAVLCFFSGIFLVKYVVMSSAASIFYSAGLVVLSF*DIL 4 FFA+LC FSGI+LV +V+M+SAA++F+S GLV+L+F D + Sbjct: 238 FFAILCIFSGIYLVNFVLMNSAANVFHSTGLVLLTFPDAM 277 >ref|XP_002519522.1| ethylene insensitive protein, putative [Ricinus communis] gi|223541385|gb|EEF42936.1| ethylene insensitive protein, putative [Ricinus communis] Length = 1290 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/51 (50%), Positives = 37/51 (72%) Frame = -1 Query: 156 VVYASPCLLCKFFAVLCFFSGIFLVKYVVMSSAASIFYSAGLVVLSF*DIL 4 +V L FFA+LC FSGI+L+ YV+M+SAA++F S GLV+L+F D + Sbjct: 227 IVSKDTLCLHHFFAILCVFSGIYLLNYVLMNSAANVFNSTGLVLLTFPDAM 277