BLASTX nr result
ID: Coptis24_contig00037202
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00037202 (477 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI38793.3| unnamed protein product [Vitis vinifera] 42 4e-06 >emb|CBI38793.3| unnamed protein product [Vitis vinifera] Length = 341 Score = 41.6 bits (96), Expect(2) = 4e-06 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -1 Query: 99 SEVVAASSTPKVEFVKKVGADKVND 25 SEVVA +STPKVEFVK +GADKV D Sbjct: 190 SEVVATASTPKVEFVKSLGADKVVD 214 Score = 33.9 bits (76), Expect(2) = 4e-06 Identities = 22/47 (46%), Positives = 27/47 (57%), Gaps = 5/47 (10%) Frame = -2 Query: 245 EDKESLALALQTATEVL-----KKAQSIFIXXXXXXVETLVVQLAKH 120 E+ SL LA+QTA E K Q++FI V TLV+QLAKH Sbjct: 139 EEAASLPLAIQTAIEGFVTAGFKGGQTVFIVGGAGGVGTLVIQLAKH 185