BLASTX nr result
ID: Coptis24_contig00037193
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00037193 (323 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK45801.1| unknown [Medicago truncatula] 60 2e-07 ref|XP_003590247.1| (RAP Annotation release2) Galactose-binding ... 60 2e-07 ref|XP_003518995.1| PREDICTED: uncharacterized protein LOC100789... 60 2e-07 ref|XP_002315341.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_002270872.1| PREDICTED: uncharacterized protein SYNPCC700... 60 2e-07 >gb|AFK45801.1| unknown [Medicago truncatula] Length = 226 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 323 LPRFMSQLVKDYQAWATGDMSRQPLGTGEI 234 LPRFMSQLVKDYQAWA+G+ SRQPLGTGEI Sbjct: 197 LPRFMSQLVKDYQAWASGNASRQPLGTGEI 226 >ref|XP_003590247.1| (RAP Annotation release2) Galactose-binding like domain containing protein [Medicago truncatula] gi|355479295|gb|AES60498.1| (RAP Annotation release2) Galactose-binding like domain containing protein [Medicago truncatula] Length = 227 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 323 LPRFMSQLVKDYQAWATGDMSRQPLGTGEI 234 LPRFMSQLVKDYQAWA+G+ SRQPLGTGEI Sbjct: 198 LPRFMSQLVKDYQAWASGNASRQPLGTGEI 227 >ref|XP_003518995.1| PREDICTED: uncharacterized protein LOC100789119 [Glycine max] Length = 228 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 323 LPRFMSQLVKDYQAWATGDMSRQPLGTGEI 234 LPRFMSQL KDYQAWA+GD SRQPLGTGEI Sbjct: 199 LPRFMSQLEKDYQAWASGDTSRQPLGTGEI 228 >ref|XP_002315341.1| predicted protein [Populus trichocarpa] gi|222864381|gb|EEF01512.1| predicted protein [Populus trichocarpa] Length = 169 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 323 LPRFMSQLVKDYQAWATGDMSRQPLGTGEI 234 LPRFM+Q+VKDYQAWA+GD SRQPLGTGEI Sbjct: 140 LPRFMAQVVKDYQAWASGDTSRQPLGTGEI 169 >ref|XP_002270872.1| PREDICTED: uncharacterized protein SYNPCC7002_A1590 [Vitis vinifera] gi|296085939|emb|CBI31380.3| unnamed protein product [Vitis vinifera] Length = 239 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 323 LPRFMSQLVKDYQAWATGDMSRQPLGTGEI 234 LPRFM+QLVKDYQ+WA+GD SRQPLGTGEI Sbjct: 210 LPRFMAQLVKDYQSWASGDASRQPLGTGEI 239