BLASTX nr result
ID: Coptis24_contig00037109
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00037109 (324 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN68400.1| hypothetical protein VITISV_041172 [Vitis vinifera] 56 3e-06 ref|XP_002267355.2| PREDICTED: BTB/POZ domain-containing protein... 55 6e-06 emb|CAN79131.1| hypothetical protein VITISV_034693 [Vitis vinifera] 55 6e-06 emb|CAN67355.1| hypothetical protein VITISV_002170 [Vitis vinifera] 55 6e-06 emb|CAN80348.1| hypothetical protein VITISV_003136 [Vitis vinifera] 55 8e-06 >emb|CAN68400.1| hypothetical protein VITISV_041172 [Vitis vinifera] Length = 1944 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/41 (58%), Positives = 31/41 (75%) Frame = +1 Query: 202 QIGFRVKWRRWIKASLSTAHFSVMVNGSPEGFFTITKGL*Q 324 +IGF VKWR WI + +ST FSV++NG P GFF+ +KGL Q Sbjct: 1517 KIGFGVKWREWIWSCISTVKFSVLINGEPAGFFSSSKGLRQ 1557 >ref|XP_002267355.2| PREDICTED: BTB/POZ domain-containing protein At1g04390-like [Vitis vinifera] Length = 890 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/41 (56%), Positives = 32/41 (78%) Frame = +1 Query: 202 QIGFRVKWRRWIKASLSTAHFSVMVNGSPEGFFTITKGL*Q 324 ++GF VKWR WI + +STA FSV++NG P GFF+ ++GL Q Sbjct: 123 KMGFGVKWREWIWSCISTAKFSVLINGEPAGFFSSSRGLRQ 163 >emb|CAN79131.1| hypothetical protein VITISV_034693 [Vitis vinifera] Length = 558 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/41 (56%), Positives = 32/41 (78%) Frame = +1 Query: 202 QIGFRVKWRRWIKASLSTAHFSVMVNGSPEGFFTITKGL*Q 324 ++GF VKWR WI + +STA FSV++NG P GFF+ ++GL Q Sbjct: 354 KMGFGVKWREWIWSCISTAKFSVLINGEPAGFFSSSRGLRQ 394 >emb|CAN67355.1| hypothetical protein VITISV_002170 [Vitis vinifera] Length = 1385 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/41 (56%), Positives = 32/41 (78%) Frame = +1 Query: 202 QIGFRVKWRRWIKASLSTAHFSVMVNGSPEGFFTITKGL*Q 324 ++GF VKWR WI + +STA FSV++NG P GFF+ ++GL Q Sbjct: 811 KMGFGVKWREWIWSCISTAKFSVLINGEPAGFFSSSRGLRQ 851 >emb|CAN80348.1| hypothetical protein VITISV_003136 [Vitis vinifera] Length = 522 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/41 (58%), Positives = 31/41 (75%) Frame = +1 Query: 202 QIGFRVKWRRWIKASLSTAHFSVMVNGSPEGFFTITKGL*Q 324 ++GF KWRRWI+ LST FSV+VNG+P GFF ++GL Q Sbjct: 317 KMGFGEKWRRWIRWCLSTVRFSVLVNGTPTGFFQSSRGLRQ 357