BLASTX nr result
ID: Coptis24_contig00037085
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00037085 (244 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003524165.1| PREDICTED: uncharacterized protein LOC100783... 82 3e-14 ref|XP_002514992.1| rothmund-thomson syndrome DNA helicase recq4... 80 2e-13 ref|XP_004135514.1| PREDICTED: ATP-dependent DNA helicase Q-like... 79 3e-13 gb|AAG50580.1|AC079280_11 ATP-dependent DNA helicase RecQ, putat... 78 6e-13 ref|NP_174109.2| ATP-dependent DNA helicase Q-like 5 [Arabidopsi... 78 6e-13 >ref|XP_003524165.1| PREDICTED: uncharacterized protein LOC100783165 [Glycine max] Length = 1272 Score = 82.4 bits (202), Expect = 3e-14 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = +2 Query: 2 DIKVFLQSNSHAKFTPSAIARIMHGIPSPAYPPSVWSKTHFW*C 133 D+KVFLQSNSHA+FTP A+AR+MHGI SPAYP + WSKTHFW C Sbjct: 1065 DLKVFLQSNSHARFTPRAVARVMHGIASPAYPSTAWSKTHFWLC 1108 >ref|XP_002514992.1| rothmund-thomson syndrome DNA helicase recq4, putative [Ricinus communis] gi|223546043|gb|EEF47546.1| rothmund-thomson syndrome DNA helicase recq4, putative [Ricinus communis] Length = 852 Score = 80.1 bits (196), Expect = 2e-13 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +2 Query: 2 DIKVFLQSNSHAKFTPSAIARIMHGIPSPAYPPSVWSKTHFW 127 DIKVFLQSNS AKFTP AIARIM GIPSPAYP + WSKTHFW Sbjct: 783 DIKVFLQSNSQAKFTPRAIARIMQGIPSPAYPSATWSKTHFW 824 >ref|XP_004135514.1| PREDICTED: ATP-dependent DNA helicase Q-like 5-like [Cucumis sativus] gi|449495007|ref|XP_004159708.1| PREDICTED: ATP-dependent DNA helicase Q-like 5-like [Cucumis sativus] Length = 952 Score = 79.3 bits (194), Expect = 3e-13 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = +2 Query: 2 DIKVFLQSNSHAKFTPSAIARIMHGIPSPAYPPSVWSKTHFW 127 DIKVFLQSNS AKFTP A+ARIMHGI SPAYP ++WS+THFW Sbjct: 882 DIKVFLQSNSQAKFTPRAVARIMHGIGSPAYPSTIWSRTHFW 923 >gb|AAG50580.1|AC079280_11 ATP-dependent DNA helicase RecQ, putative [Arabidopsis thaliana] Length = 941 Score = 78.2 bits (191), Expect = 6e-13 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +2 Query: 2 DIKVFLQSNSHAKFTPSAIARIMHGIPSPAYPPSVWSKTHFW 127 DIKVFLQSN AKFTP AIARIMHG+ SPA+P SVWSKTHFW Sbjct: 869 DIKVFLQSNRQAKFTPRAIARIMHGVGSPAFPNSVWSKTHFW 910 >ref|NP_174109.2| ATP-dependent DNA helicase Q-like 5 [Arabidopsis thaliana] gi|298289257|sp|Q0WVW7.2|RQL5_ARATH RecName: Full=ATP-dependent DNA helicase Q-like 5; AltName: Full=RecQ-like protein 5; Short=AtRecQ5; Short=AtRecQl5 gi|332192766|gb|AEE30887.1| ATP-dependent DNA helicase Q-like 5 [Arabidopsis thaliana] Length = 911 Score = 78.2 bits (191), Expect = 6e-13 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = +2 Query: 2 DIKVFLQSNSHAKFTPSAIARIMHGIPSPAYPPSVWSKTHFW 127 DIKVFLQSN AKFTP AIARIMHG+ SPA+P SVWSKTHFW Sbjct: 839 DIKVFLQSNRQAKFTPRAIARIMHGVGSPAFPNSVWSKTHFW 880