BLASTX nr result
ID: Coptis24_contig00035455
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00035455 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002872017.1| predicted protein [Arabidopsis lyrata subsp.... 55 4e-06 >ref|XP_002872017.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297317854|gb|EFH48276.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 926 Score = 55.5 bits (132), Expect = 4e-06 Identities = 23/51 (45%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = +2 Query: 2 KNLETLPDGLRFITSLQKLVIGLMPKEFKDR-VQGEEELYKVRHIPSITCY 151 + L++LPDGL++IT+L++L +G M EFKD+ +QG ++ YK++H+ S+ Y Sbjct: 871 RKLKSLPDGLKYITTLEELRVGWMQNEFKDKLIQGGDDHYKIQHVSSVVFY 921