BLASTX nr result
ID: Coptis24_contig00035348
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00035348 (248 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275192.1| PREDICTED: probable pectinesterase/pectinest... 57 2e-06 >ref|XP_002275192.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 51 [Vitis vinifera] Length = 553 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/51 (50%), Positives = 33/51 (64%) Frame = +1 Query: 94 TNPSQIAQQACKATRNIEACVTTITQSPTLPPNPKPLDVINSAIWATSKNL 246 T+P QQACKATR E C + S +PPNP P+ +I SAIW +S+NL Sbjct: 34 TSPKPQIQQACKATRFPETCEAFLRGSGHVPPNPSPVQIIQSAIWVSSENL 84