BLASTX nr result
ID: Coptis24_contig00035321
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00035321 (247 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002870709.1| binding protein [Arabidopsis lyrata subsp. l... 60 2e-07 >ref|XP_002870709.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297316545|gb|EFH46968.1| binding protein [Arabidopsis lyrata subsp. lyrata] Length = 608 Score = 60.1 bits (144), Expect = 2e-07 Identities = 31/49 (63%), Positives = 38/49 (77%), Gaps = 3/49 (6%) Frame = -1 Query: 139 FSTSSL---SNPTPKPLLITNPLYNLLPQTQNPNKIVNLICSHLKHNNN 2 FS+SS+ N PKP+L NPLYNLLPQTQNPNKIV++ICS L H ++ Sbjct: 11 FSSSSIVPRCNNIPKPIL--NPLYNLLPQTQNPNKIVDVICSTLNHRDH 57