BLASTX nr result
ID: Coptis24_contig00035267
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00035267 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAJ53228.1| JHL06P13.8 [Jatropha curcas] 67 1e-09 ref|NP_564611.1| Putative thiol-disulfide oxidoreductase DCC [Ar... 64 1e-08 ref|XP_003546930.1| PREDICTED: DCC family protein At1g52590, chl... 64 1e-08 ref|NP_001235907.1| uncharacterized protein LOC100305986 [Glycin... 64 1e-08 gb|AAM65780.1| unknown [Arabidopsis thaliana] 64 1e-08 >dbj|BAJ53228.1| JHL06P13.8 [Jatropha curcas] Length = 178 Score = 67.0 bits (162), Expect = 1e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +2 Query: 2 FLQFIPLFVRDFVYENVANNRYTIFGRSESCEL 100 FLQF+PLF+RDF Y+NVANNRYTIFGRSESCE+ Sbjct: 143 FLQFVPLFIRDFAYDNVANNRYTIFGRSESCEV 175 >ref|NP_564611.1| Putative thiol-disulfide oxidoreductase DCC [Arabidopsis thaliana] gi|75207555|sp|Q9SSR1.1|Y1259_ARATH RecName: Full=DCC family protein At1g52590, chloroplastic; Flags: Precursor gi|5903046|gb|AAD55605.1|AC008016_15 F6D8.19 [Arabidopsis thaliana] gi|26450069|dbj|BAC42154.1| unknown protein [Arabidopsis thaliana] gi|28827528|gb|AAO50608.1| unknown protein [Arabidopsis thaliana] gi|332194706|gb|AEE32827.1| Putative thiol-disulfide oxidoreductase DCC [Arabidopsis thaliana] Length = 172 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +2 Query: 2 FLQFIPLFVRDFVYENVANNRYTIFGRSESCEL 100 FLQF PLFVRDF+YENVANNRY +FGRS+SCEL Sbjct: 140 FLQFAPLFVRDFLYENVANNRYAMFGRSDSCEL 172 >ref|XP_003546930.1| PREDICTED: DCC family protein At1g52590, chloroplastic-like [Glycine max] Length = 114 Score = 64.3 bits (155), Expect = 1e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +2 Query: 5 LQFIPLFVRDFVYENVANNRYTIFGRSESCEL 100 LQF+PLF+RDFVY+NVANNRY IFGRSESCE+ Sbjct: 83 LQFVPLFIRDFVYDNVANNRYQIFGRSESCEI 114 >ref|NP_001235907.1| uncharacterized protein LOC100305986 [Glycine max] gi|255627201|gb|ACU13945.1| unknown [Glycine max] Length = 172 Score = 64.3 bits (155), Expect = 1e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +2 Query: 5 LQFIPLFVRDFVYENVANNRYTIFGRSESCEL 100 LQF+PLF+RDFVY+NVANNRY IFGRSESCE+ Sbjct: 141 LQFVPLFIRDFVYDNVANNRYLIFGRSESCEI 172 >gb|AAM65780.1| unknown [Arabidopsis thaliana] Length = 172 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +2 Query: 2 FLQFIPLFVRDFVYENVANNRYTIFGRSESCEL 100 FLQF PLFVRDF+YENVANNRY +FGRS+SCEL Sbjct: 140 FLQFAPLFVRDFLYENVANNRYAMFGRSDSCEL 172