BLASTX nr result
ID: Coptis24_contig00035019
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00035019 (244 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004137012.1| PREDICTED: pentatricopeptide repeat-containi... 55 8e-06 >ref|XP_004137012.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03540-like [Cucumis sativus] gi|449493172|ref|XP_004159212.1| PREDICTED: pentatricopeptide repeat-containing protein At1g03540-like [Cucumis sativus] Length = 605 Score = 54.7 bits (130), Expect = 8e-06 Identities = 21/45 (46%), Positives = 35/45 (77%) Frame = +2 Query: 5 DMVMKTALIDMYVKCKCINNAYRIFKDEIPVKDEVTWTLMLSGFS 139 D+++++AL+D+Y KC CIN AYR+F D +P ++ +TW M+ GF+ Sbjct: 395 DVIVESALVDLYAKCGCINFAYRVF-DRMPTRNLITWNSMIHGFA 438