BLASTX nr result
ID: Coptis24_contig00034849
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00034849 (423 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003605676.1| ATP-dependent DNA helicase PIF1 [Medicago tr... 55 5e-06 ref|XP_003600273.1| ATP-dependent DNA helicase PIF1 [Medicago tr... 55 5e-06 >ref|XP_003605676.1| ATP-dependent DNA helicase PIF1 [Medicago truncatula] gi|355506731|gb|AES87873.1| ATP-dependent DNA helicase PIF1 [Medicago truncatula] Length = 1561 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/52 (51%), Positives = 35/52 (67%) Frame = -2 Query: 422 NWDEIKSFLELNPGLNPHDVPDVGCRAFKLKLECIMKKLRKGEHFGRVIAGM 267 NW EI+ F+ + GL D PD+ CR FK+KL+ IM +K E FG+VIAGM Sbjct: 600 NWPEIRDFVT-SKGLQASDRPDIVCRVFKMKLDEIMADFKKNEIFGKVIAGM 650 >ref|XP_003600273.1| ATP-dependent DNA helicase PIF1 [Medicago truncatula] gi|355489321|gb|AES70524.1| ATP-dependent DNA helicase PIF1 [Medicago truncatula] Length = 1634 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/52 (51%), Positives = 35/52 (67%) Frame = -2 Query: 422 NWDEIKSFLELNPGLNPHDVPDVGCRAFKLKLECIMKKLRKGEHFGRVIAGM 267 NW EI+ F+ + GL D PD+ CR FK+KL+ IM +K E FG+VIAGM Sbjct: 627 NWPEIRDFVT-SKGLQASDRPDIVCRVFKMKLDEIMADFKKNEIFGKVIAGM 677