BLASTX nr result
ID: Coptis24_contig00034839
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00034839 (243 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277748.2| PREDICTED: disease resistance protein RPS5-l... 55 6e-06 emb|CAN80410.1| hypothetical protein VITISV_018933 [Vitis vinifera] 55 8e-06 >ref|XP_002277748.2| PREDICTED: disease resistance protein RPS5-like [Vitis vinifera] Length = 883 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/47 (46%), Positives = 32/47 (68%), Gaps = 1/47 (2%) Frame = -2 Query: 140 AFPFHQVNEV-MYKCLSLRRLPLQSDSCQNRLQFIGGDPDWWNNLEW 3 A PFH + ++ +Y C +LR+LPL S+S N L+ I G+ WW NL+W Sbjct: 821 ALPFHSLKKIHVYHCPNLRKLPLNSNSASNTLKIIEGESSWWENLQW 867 >emb|CAN80410.1| hypothetical protein VITISV_018933 [Vitis vinifera] Length = 881 Score = 54.7 bits (130), Expect = 8e-06 Identities = 22/47 (46%), Positives = 32/47 (68%), Gaps = 1/47 (2%) Frame = -2 Query: 140 AFPFHQVNEV-MYKCLSLRRLPLQSDSCQNRLQFIGGDPDWWNNLEW 3 A PFH + ++ +Y C +LR+LPL S+S N L+ I G+ WW NL+W Sbjct: 819 ALPFHSLKKIHVYHCPNLRKLPLNSNSASNTLKIIEGESSWWENLKW 865