BLASTX nr result
ID: Coptis24_contig00034560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00034560 (342 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001143807.1| uncharacterized protein LOC100276581 [Zea ma... 58 9e-07 gb|ACF86581.1| unknown [Zea mays] gi|413945382|gb|AFW78031.1| hy... 58 9e-07 gb|ACF79722.1| unknown [Zea mays] gi|413945383|gb|AFW78032.1| hy... 58 9e-07 ref|XP_002524573.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 ref|XP_002531112.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|NP_001143807.1| uncharacterized protein LOC100276581 [Zea mays] gi|195627486|gb|ACG35573.1| hypothetical protein [Zea mays] Length = 156 Score = 57.8 bits (138), Expect = 9e-07 Identities = 23/42 (54%), Positives = 30/42 (71%) Frame = +3 Query: 216 PRRVPLKAHNSNWKEKLRDNCFKRIREDRNKLLWKMRAPSQP 341 P RV +KAH +WK +LR NC +R+R+DRN LLWK+R P Sbjct: 6 PMRVSIKAHRPDWKSELRTNCLRRVRKDRNDLLWKIRKQGLP 47 >gb|ACF86581.1| unknown [Zea mays] gi|413945382|gb|AFW78031.1| hypothetical protein ZEAMMB73_156976 [Zea mays] Length = 156 Score = 57.8 bits (138), Expect = 9e-07 Identities = 23/42 (54%), Positives = 30/42 (71%) Frame = +3 Query: 216 PRRVPLKAHNSNWKEKLRDNCFKRIREDRNKLLWKMRAPSQP 341 P RV +KAH +WK +LR NC +R+R+DRN LLWK+R P Sbjct: 6 PMRVSIKAHRPDWKSELRTNCLRRVRKDRNDLLWKIRKQGLP 47 >gb|ACF79722.1| unknown [Zea mays] gi|413945383|gb|AFW78032.1| hypothetical protein ZEAMMB73_156976 [Zea mays] Length = 240 Score = 57.8 bits (138), Expect = 9e-07 Identities = 23/42 (54%), Positives = 30/42 (71%) Frame = +3 Query: 216 PRRVPLKAHNSNWKEKLRDNCFKRIREDRNKLLWKMRAPSQP 341 P RV +KAH +WK +LR NC +R+R+DRN LLWK+R P Sbjct: 6 PMRVSIKAHRPDWKSELRTNCLRRVRKDRNDLLWKIRKQGLP 47 >ref|XP_002524573.1| conserved hypothetical protein [Ricinus communis] gi|223536126|gb|EEF37781.1| conserved hypothetical protein [Ricinus communis] Length = 262 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/48 (52%), Positives = 34/48 (70%), Gaps = 5/48 (10%) Frame = +3 Query: 207 TMEPRRVPLKAHNSN-----WKEKLRDNCFKRIREDRNKLLWKMRAPS 335 T P+R +K + WK+KLR+NC+KR+REDRN+LLWKMR P+ Sbjct: 11 TPPPKRQSIKTQSHFNTYPLWKDKLRENCYKRVREDRNRLLWKMRLPT 58 >ref|XP_002531112.1| conserved hypothetical protein [Ricinus communis] gi|223529308|gb|EEF31277.1| conserved hypothetical protein [Ricinus communis] Length = 308 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/48 (52%), Positives = 34/48 (70%), Gaps = 5/48 (10%) Frame = +3 Query: 207 TMEPRRVPLKAHNSN-----WKEKLRDNCFKRIREDRNKLLWKMRAPS 335 T P+R +K + WK+KLR+NC+KR+REDRN+LLWKMR P+ Sbjct: 11 TPPPKRQSIKTQSHFNTYPLWKDKLRENCYKRVREDRNRLLWKMRLPT 58