BLASTX nr result
ID: Coptis24_contig00034480
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00034480 (278 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535059.1| conserved hypothetical protein [Ricinus comm... 77 2e-12 >ref|XP_002535059.1| conserved hypothetical protein [Ricinus communis] gi|223524111|gb|EEF27320.1| conserved hypothetical protein [Ricinus communis] Length = 75 Score = 76.6 bits (187), Expect = 2e-12 Identities = 37/60 (61%), Positives = 43/60 (71%) Frame = -1 Query: 182 IDGTFPLTPPVLVQERVNARILLRSISGVCPYPNGSCKKIGFHIELQIYAIGMGWLLLAL 3 +D F PP ++ ++ISGV PYPNGSCKKIGFHIELQIYAIG+GWLLLAL Sbjct: 14 LDPLFLSPPPFWFRKGSTQGSYFKAISGVFPYPNGSCKKIGFHIELQIYAIGIGWLLLAL 73