BLASTX nr result
ID: Coptis24_contig00034292
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00034292 (478 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003538642.1| PREDICTED: uncharacterized protein LOC100802... 69 3e-10 ref|XP_002278526.1| PREDICTED: uncharacterized protein LOC100249... 69 4e-10 ref|NP_188884.1| 50S ribosomal protein L18-like protein [Arabido... 67 1e-09 ref|XP_002883368.1| structural constituent of ribosome [Arabidop... 67 2e-09 ref|XP_002311628.1| predicted protein [Populus trichocarpa] gi|2... 67 2e-09 >ref|XP_003538642.1| PREDICTED: uncharacterized protein LOC100802391 [Glycine max] Length = 329 Score = 69.3 bits (168), Expect = 3e-10 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = +1 Query: 1 QRALADDIHDIVYTPRKGDKVEGKLQIVLQSLIDHG 108 QRALADDIHDIVYTPRKG++VEGKLQIVLQS+ID+G Sbjct: 276 QRALADDIHDIVYTPRKGERVEGKLQIVLQSIIDNG 311 >ref|XP_002278526.1| PREDICTED: uncharacterized protein LOC100249372 [Vitis vinifera] gi|297737055|emb|CBI26256.3| unnamed protein product [Vitis vinifera] Length = 348 Score = 68.9 bits (167), Expect = 4e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +1 Query: 1 QRALADDIHDIVYTPRKGDKVEGKLQIVLQSLIDHG 108 QRALADDIHD VYTPRKGDK+EGKLQIVLQS+ID+G Sbjct: 287 QRALADDIHDTVYTPRKGDKLEGKLQIVLQSIIDNG 322 >ref|NP_188884.1| 50S ribosomal protein L18-like protein [Arabidopsis thaliana] gi|11994277|dbj|BAB01460.1| unnamed protein product [Arabidopsis thaliana] gi|60547769|gb|AAX23848.1| hypothetical protein At3g22450 [Arabidopsis thaliana] gi|71905479|gb|AAZ52717.1| expressed protein [Arabidopsis thaliana] gi|71905481|gb|AAZ52718.1| expressed protein [Arabidopsis thaliana] gi|332643120|gb|AEE76641.1| 50S ribosomal protein L18-like protein [Arabidopsis thaliana] Length = 311 Score = 67.0 bits (162), Expect = 1e-09 Identities = 28/36 (77%), Positives = 35/36 (97%) Frame = +1 Query: 1 QRALADDIHDIVYTPRKGDKVEGKLQIVLQSLIDHG 108 QR+L DDIHD++YTPRKGDK+EGKLQ+VLQ+LID+G Sbjct: 254 QRSLEDDIHDVIYTPRKGDKIEGKLQVVLQALIDNG 289 >ref|XP_002883368.1| structural constituent of ribosome [Arabidopsis lyrata subsp. lyrata] gi|297329208|gb|EFH59627.1| structural constituent of ribosome [Arabidopsis lyrata subsp. lyrata] Length = 311 Score = 66.6 bits (161), Expect = 2e-09 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = +1 Query: 1 QRALADDIHDIVYTPRKGDKVEGKLQIVLQSLIDHG 108 QR L DDIHD++YTPRKGDK+EGKLQ+VLQ+LID+G Sbjct: 254 QRCLEDDIHDVIYTPRKGDKIEGKLQVVLQALIDNG 289 >ref|XP_002311628.1| predicted protein [Populus trichocarpa] gi|222851448|gb|EEE88995.1| predicted protein [Populus trichocarpa] Length = 356 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/36 (80%), Positives = 36/36 (100%) Frame = +1 Query: 1 QRALADDIHDIVYTPRKGDKVEGKLQIVLQSLIDHG 108 QRALADDIHD+VYTPRKG+++EGKLQIVLQ++ID+G Sbjct: 290 QRALADDIHDVVYTPRKGERLEGKLQIVLQAIIDNG 325