BLASTX nr result
ID: Coptis24_contig00034242
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00034242 (356 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_002836134.1| hypothetical chloroplast RF2 [Megaleranthis ... 117 1e-27 ref|YP_001004228.1| hypothetical chloroplast RF2 [Ranunculus mac... 116 3e-27 ref|YP_740694.1| hypothetical chloroplast RF2 [Nandina domestica... 114 2e-26 gb|AEX99130.1| hypothetical chloroplast RF2 (chloroplast) [Magno... 114 2e-26 ref|YP_007474579.1| hypothetical chloroplast RF2 (chloroplast) [... 114 2e-26 >ref|YP_002836134.1| hypothetical chloroplast RF2 [Megaleranthis saniculifolia] gi|229577815|ref|YP_002836151.1| hypothetical chloroplast RF2 [Megaleranthis saniculifolia] gi|226933926|gb|ACO92059.1| hypothetical chloroplast RF2 [Megaleranthis saniculifolia] gi|226933943|gb|ACO92076.1| hypothetical chloroplast RF2 [Megaleranthis saniculifolia] Length = 2288 Score = 117 bits (294), Expect(2) = 1e-27 Identities = 58/59 (98%), Positives = 58/59 (98%) Frame = +1 Query: 121 LHLGSNPTEGSTRDQKLLKKQQDFSFVPSRRSENKEMVDIFKIITYLQNTVSIHPISSD 297 LHLGSNPTEGSTRDQK LKKQQDFSFVPSRRSENKEMVDIFKIITYLQNTVSIHPISSD Sbjct: 507 LHLGSNPTEGSTRDQKWLKKQQDFSFVPSRRSENKEMVDIFKIITYLQNTVSIHPISSD 565 Score = 30.0 bits (66), Expect(2) = 1e-27 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 300 GCDMVPKDEPD 332 GCDMVPKDEPD Sbjct: 567 GCDMVPKDEPD 577 >ref|YP_001004228.1| hypothetical chloroplast RF2 [Ranunculus macranthus] gi|122894049|ref|YP_001004245.1| hypothetical chloroplast RF2 [Ranunculus macranthus] gi|205413370|sp|A1XGT0.1|YCF2_RANMC RecName: Full=Protein ycf2 gi|85540846|gb|ABC70798.1| hypothetical chloroplast RF2 [Ranunculus macranthus] gi|85540863|gb|ABC70815.1| hypothetical chloroplast RF2 [Ranunculus macranthus] Length = 2294 Score = 116 bits (291), Expect(2) = 3e-27 Identities = 57/59 (96%), Positives = 58/59 (98%) Frame = +1 Query: 121 LHLGSNPTEGSTRDQKLLKKQQDFSFVPSRRSENKEMVDIFKIITYLQNTVSIHPISSD 297 LHLGSNPTEGSTRDQKLLKKQQDFSFVPSRRSENKEMVDIF+IITYLQNTVSIHPI SD Sbjct: 502 LHLGSNPTEGSTRDQKLLKKQQDFSFVPSRRSENKEMVDIFRIITYLQNTVSIHPILSD 560 Score = 30.0 bits (66), Expect(2) = 3e-27 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 300 GCDMVPKDEPD 332 GCDMVPKDEPD Sbjct: 562 GCDMVPKDEPD 572 >ref|YP_740694.1| hypothetical chloroplast RF2 [Nandina domestica] gi|114330032|ref|YP_740713.1| hypothetical chloroplast RF2 [Nandina domestica] gi|122165906|sp|Q09FP8.1|YCF2_NANDO RecName: Full=Protein ycf2 gi|114054515|gb|ABI49908.1| hypothetical chloroplast RF2 [Nandina domestica] gi|114054534|gb|ABI49927.1| hypothetical chloroplast RF2 [Nandina domestica] Length = 2299 Score = 114 bits (285), Expect(2) = 2e-26 Identities = 57/59 (96%), Positives = 57/59 (96%) Frame = +1 Query: 121 LHLGSNPTEGSTRDQKLLKKQQDFSFVPSRRSENKEMVDIFKIITYLQNTVSIHPISSD 297 LHLGSNPTE STRDQKLLKKQQD SFVPSRRSENKEMVDIFKIITYLQNTVSIHPISSD Sbjct: 510 LHLGSNPTERSTRDQKLLKKQQDVSFVPSRRSENKEMVDIFKIITYLQNTVSIHPISSD 568 Score = 30.0 bits (66), Expect(2) = 2e-26 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 300 GCDMVPKDEPD 332 GCDMVPKDEPD Sbjct: 570 GCDMVPKDEPD 580 >gb|AEX99130.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia grandiflora] Length = 2298 Score = 114 bits (285), Expect(2) = 2e-26 Identities = 57/59 (96%), Positives = 57/59 (96%) Frame = +1 Query: 121 LHLGSNPTEGSTRDQKLLKKQQDFSFVPSRRSENKEMVDIFKIITYLQNTVSIHPISSD 297 LHLGSNPTE STRDQKLLKKQQD SFVPSRRSENKEMVDIFKIITYLQNTVSIHPISSD Sbjct: 507 LHLGSNPTERSTRDQKLLKKQQDVSFVPSRRSENKEMVDIFKIITYLQNTVSIHPISSD 565 Score = 30.0 bits (66), Expect(2) = 2e-26 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 300 GCDMVPKDEPD 332 GCDMVPKDEPD Sbjct: 567 GCDMVPKDEPD 577 >ref|YP_007474579.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia grandiflora] gi|452848915|ref|YP_007474596.1| photosystem I assembly protein Ycf2 (chloroplast) [Magnolia grandiflora] gi|372862885|gb|AEX98961.1| hypothetical chloroplast RF2 (chloroplast) [Magnolia grandiflora] gi|372862902|gb|AEX98978.1| photosystem I assembly protein Ycf2 (chloroplast) [Magnolia grandiflora] Length = 2298 Score = 114 bits (285), Expect(2) = 2e-26 Identities = 57/59 (96%), Positives = 57/59 (96%) Frame = +1 Query: 121 LHLGSNPTEGSTRDQKLLKKQQDFSFVPSRRSENKEMVDIFKIITYLQNTVSIHPISSD 297 LHLGSNPTE STRDQKLLKKQQD SFVPSRRSENKEMVDIFKIITYLQNTVSIHPISSD Sbjct: 507 LHLGSNPTERSTRDQKLLKKQQDVSFVPSRRSENKEMVDIFKIITYLQNTVSIHPISSD 565 Score = 30.0 bits (66), Expect(2) = 2e-26 Identities = 11/11 (100%), Positives = 11/11 (100%) Frame = +3 Query: 300 GCDMVPKDEPD 332 GCDMVPKDEPD Sbjct: 567 GCDMVPKDEPD 577