BLASTX nr result
ID: Coptis24_contig00034078
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00034078 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281998.2| PREDICTED: pentatricopeptide repeat-containi... 94 2e-17 ref|XP_003527761.1| PREDICTED: pentatricopeptide repeat-containi... 94 2e-17 emb|CBI20738.3| unnamed protein product [Vitis vinifera] 94 2e-17 emb|CAN76239.1| hypothetical protein VITISV_016538 [Vitis vinifera] 94 2e-17 ref|XP_002867196.1| pentatricopeptide repeat-containing protein ... 92 4e-17 >ref|XP_002281998.2| PREDICTED: pentatricopeptide repeat-containing protein At4g33170 [Vitis vinifera] Length = 1580 Score = 93.6 bits (231), Expect = 2e-17 Identities = 40/48 (83%), Positives = 43/48 (89%) Frame = -3 Query: 253 VIKNLRVCGDCHNAIKYISRTVEREIVVRDANRFHCFKKGTCSCGDYW 110 VIKNLRVCGDCHNAIKYIS+ EREIV+RDANRFH F+ G CSCGDYW Sbjct: 1533 VIKNLRVCGDCHNAIKYISKVFEREIVLRDANRFHHFRDGVCSCGDYW 1580 >ref|XP_003527761.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Glycine max] Length = 1582 Score = 93.6 bits (231), Expect = 2e-17 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = -3 Query: 253 VIKNLRVCGDCHNAIKYISRTVEREIVVRDANRFHCFKKGTCSCGDYW 110 VIKNLRVCGDCHNAIKYIS+ ERE+V+RDANRFH F+ G CSCGDYW Sbjct: 1535 VIKNLRVCGDCHNAIKYISKVFEREVVLRDANRFHHFRSGVCSCGDYW 1582 >emb|CBI20738.3| unnamed protein product [Vitis vinifera] Length = 865 Score = 93.6 bits (231), Expect = 2e-17 Identities = 40/48 (83%), Positives = 43/48 (89%) Frame = -3 Query: 253 VIKNLRVCGDCHNAIKYISRTVEREIVVRDANRFHCFKKGTCSCGDYW 110 VIKNLRVCGDCHNAIKYIS+ EREIV+RDANRFH F+ G CSCGDYW Sbjct: 818 VIKNLRVCGDCHNAIKYISKVFEREIVLRDANRFHHFRDGVCSCGDYW 865 >emb|CAN76239.1| hypothetical protein VITISV_016538 [Vitis vinifera] Length = 503 Score = 93.6 bits (231), Expect = 2e-17 Identities = 40/48 (83%), Positives = 43/48 (89%) Frame = -3 Query: 253 VIKNLRVCGDCHNAIKYISRTVEREIVVRDANRFHCFKKGTCSCGDYW 110 VIKNLRVCGDCHNAIKYIS+ EREIV+RDANRFH F+ G CSCGDYW Sbjct: 456 VIKNLRVCGDCHNAIKYISKVFEREIVLRDANRFHHFRDGVCSCGDYW 503 >ref|XP_002867196.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297313032|gb|EFH43455.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 997 Score = 92.0 bits (227), Expect = 4e-17 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = -3 Query: 253 VIKNLRVCGDCHNAIKYISRTVEREIVVRDANRFHCFKKGTCSCGDYW 110 VIKNLRVCGDCHNA+KYIS+ +REIV+RDANRFH FK G CSCGDYW Sbjct: 950 VIKNLRVCGDCHNAMKYISKVYDREIVLRDANRFHRFKDGICSCGDYW 997