BLASTX nr result
ID: Coptis24_contig00033554
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00033554 (208 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC39181.1| thaumatin-like protein [Actinidia chinensis] 72 4e-11 ref|XP_002457489.1| hypothetical protein SORBIDRAFT_03g008160 [S... 72 4e-11 gb|AAB61590.1| VVTL1 [Vitis vinifera] 71 8e-11 pdb|4H8T|A Chain A, Structure Of Haze Forming Proteins In White ... 71 8e-11 emb|CBI34739.3| unnamed protein product [Vitis vinifera] 71 8e-11 >gb|AGC39181.1| thaumatin-like protein [Actinidia chinensis] Length = 228 Score = 72.4 bits (176), Expect = 4e-11 Identities = 32/46 (69%), Positives = 35/46 (76%) Frame = -3 Query: 206 GKCEPTLYSKFFKDNCPDAYSYHLDQDLANPFTYPSGTNYKIVFCP 69 G CEPT YSKFFKD CPDAYSY D D + FT P GTNY++VFCP Sbjct: 184 GSCEPTTYSKFFKDRCPDAYSYPQD-DPTSLFTCPGGTNYRVVFCP 228 >ref|XP_002457489.1| hypothetical protein SORBIDRAFT_03g008160 [Sorghum bicolor] gi|241929464|gb|EES02609.1| hypothetical protein SORBIDRAFT_03g008160 [Sorghum bicolor] Length = 640 Score = 72.4 bits (176), Expect = 4e-11 Identities = 35/59 (59%), Positives = 37/59 (62%), Gaps = 4/59 (6%) Frame = -3 Query: 200 CEPTLYSKFFKDNCPDAYSYHLDQDLANPFTYPSGTNYKIVFCP----SRPTNIANPPT 36 CEPT YS FF CPDAYSY D D + FT PSGTNY+IVFCP S NPPT Sbjct: 190 CEPTTYSVFFVRGCPDAYSYSRDDDSSTTFTCPSGTNYQIVFCPPVDISASPPATNPPT 248 >gb|AAB61590.1| VVTL1 [Vitis vinifera] Length = 222 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/46 (69%), Positives = 34/46 (73%) Frame = -3 Query: 206 GKCEPTLYSKFFKDNCPDAYSYHLDQDLANPFTYPSGTNYKIVFCP 69 G C PT YSKFFKD CPDAYSY D D + FT PSGTNYK+ FCP Sbjct: 178 GSCGPTTYSKFFKDRCPDAYSYPQD-DKTSLFTCPSGTNYKVTFCP 222 >pdb|4H8T|A Chain A, Structure Of Haze Forming Proteins In White Wines: Vitis Vinifera Thaumatin-Like Proteins gi|410563155|pdb|4H8T|B Chain B, Structure Of Haze Forming Proteins In White Wines: Vitis Vinifera Thaumatin-Like Proteins Length = 198 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/46 (69%), Positives = 34/46 (73%) Frame = -3 Query: 206 GKCEPTLYSKFFKDNCPDAYSYHLDQDLANPFTYPSGTNYKIVFCP 69 G C PT YSKFFKD CPDAYSY D D + FT PSGTNYK+ FCP Sbjct: 154 GSCGPTTYSKFFKDRCPDAYSYPQD-DKTSLFTCPSGTNYKVTFCP 198 >emb|CBI34739.3| unnamed protein product [Vitis vinifera] Length = 110 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/46 (69%), Positives = 34/46 (73%) Frame = -3 Query: 206 GKCEPTLYSKFFKDNCPDAYSYHLDQDLANPFTYPSGTNYKIVFCP 69 G C PT YSKFFKD CPDAYSY D D + FT PSGTNYK+ FCP Sbjct: 66 GSCGPTTYSKFFKDRCPDAYSYPQD-DKTSLFTCPSGTNYKVTFCP 110