BLASTX nr result
ID: Coptis24_contig00033275
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00033275 (348 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525313.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >ref|XP_002525313.1| conserved hypothetical protein [Ricinus communis] gi|223535372|gb|EEF37046.1| conserved hypothetical protein [Ricinus communis] Length = 583 Score = 55.1 bits (131), Expect = 6e-06 Identities = 31/73 (42%), Positives = 40/73 (54%) Frame = +1 Query: 88 NGFFLQPFAPPVQTSGGRRAYRNKKSLRAQILPSKTQRIMEXXXXXXXXXXXXXXXXYNA 267 NG F P P+ R R+ SL+AQ +PS+TQRIME Y+A Sbjct: 10 NGLFSYPKLSPLLQRRKERTQRSM-SLQAQAVPSRTQRIMESISVSNEVGGAGGAYSYDA 68 Query: 268 LKRLDQLWTNICS 306 LKRLDQ+W++ICS Sbjct: 69 LKRLDQIWSSICS 81