BLASTX nr result
ID: Coptis24_contig00033249
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00033249 (382 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004154592.1| PREDICTED: F-box protein SKIP23-like [Cucumi... 61 8e-08 ref|XP_004140043.1| PREDICTED: F-box protein SKIP23-like [Cucumi... 61 8e-08 >ref|XP_004154592.1| PREDICTED: F-box protein SKIP23-like [Cucumis sativus] Length = 458 Score = 61.2 bits (147), Expect = 8e-08 Identities = 25/51 (49%), Positives = 38/51 (74%) Frame = +1 Query: 184 WIIKVEEDTPNVIHLMDPLSRNFMSPKPKTFPKGLNVLDFNIYGICKEYLL 336 W+IKVEED +I + +PLS+++ P PK FPK LN+L+F + +C+EY+L Sbjct: 85 WLIKVEEDACGMIKISNPLSKSYFKPLPKNFPKVLNLLNFPVLELCQEYVL 135 >ref|XP_004140043.1| PREDICTED: F-box protein SKIP23-like [Cucumis sativus] Length = 404 Score = 61.2 bits (147), Expect = 8e-08 Identities = 25/51 (49%), Positives = 38/51 (74%) Frame = +1 Query: 184 WIIKVEEDTPNVIHLMDPLSRNFMSPKPKTFPKGLNVLDFNIYGICKEYLL 336 W+IKVEED +I + +PLS+++ P PK FPK LN+L+F + +C+EY+L Sbjct: 85 WLIKVEEDACGMIKISNPLSKSYFKPLPKNFPKVLNLLNFPVLELCQEYVL 135