BLASTX nr result
ID: Coptis24_contig00033182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00033182 (402 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533067.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 ref|XP_002320394.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 ref|XP_002302826.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 >ref|XP_002533067.1| conserved hypothetical protein [Ricinus communis] gi|223527131|gb|EEF29306.1| conserved hypothetical protein [Ricinus communis] Length = 143 Score = 59.7 bits (143), Expect = 2e-07 Identities = 23/39 (58%), Positives = 30/39 (76%) Frame = -1 Query: 276 IDNCCRWLRNLDDTCVCELLIRLPPFLRAQEHCVTMSVA 160 +D+CCRWL +LDD C+CELL+RLPPFL H T+ +A Sbjct: 90 VDDCCRWLNDLDDECICELLVRLPPFLARPLHQYTVVIA 128 >ref|XP_002320394.1| predicted protein [Populus trichocarpa] gi|222861167|gb|EEE98709.1| predicted protein [Populus trichocarpa] Length = 152 Score = 56.6 bits (135), Expect = 2e-06 Identities = 22/38 (57%), Positives = 28/38 (73%) Frame = -1 Query: 273 DNCCRWLRNLDDTCVCELLIRLPPFLRAQEHCVTMSVA 160 DNCC+WL+ LD+ CVC++L RLPPFL H T+ VA Sbjct: 102 DNCCKWLKELDEECVCDVLYRLPPFLSKPTHTYTVYVA 139 >ref|XP_002302826.1| predicted protein [Populus trichocarpa] gi|222844552|gb|EEE82099.1| predicted protein [Populus trichocarpa] Length = 139 Score = 56.2 bits (134), Expect = 3e-06 Identities = 21/37 (56%), Positives = 27/37 (72%) Frame = -1 Query: 273 DNCCRWLRNLDDTCVCELLIRLPPFLRAQEHCVTMSV 163 D CCRWL ++DD CVC+LL+RLPPFL H T+ + Sbjct: 90 DTCCRWLNDVDDECVCQLLVRLPPFLSRTRHEYTIKI 126