BLASTX nr result
ID: Coptis24_contig00033053
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00033053 (470 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM63520.1| DnaJ protein, putative [Arabidopsis thaliana] 91 8e-17 ref|NP_565034.1| chaperone DnaJ-domain containing protein [Arabi... 90 2e-16 ref|ZP_03544762.1| chaperone protein DnaJ [Comamonas testosteron... 66 3e-09 ref|ZP_13096525.1| chaperone protein DnaJ [Comamonas testosteron... 65 8e-09 ref|YP_003277052.1| molecular chaperone DnaJ [Comamonas testoste... 63 2e-08 >gb|AAM63520.1| DnaJ protein, putative [Arabidopsis thaliana] Length = 126 Score = 91.3 bits (225), Expect = 8e-17 Identities = 54/103 (52%), Positives = 65/103 (63%), Gaps = 2/103 (1%) Frame = -2 Query: 454 RGVSFQTRSL--PISDAFAVLGLTPFASKSDVKHAYKRLALKFHPDVIKGDNVNEKQETF 281 R + F TR P + VLGLTP AS+++VK A+KRLALK+HPDV KG + + F Sbjct: 24 RLIRFPTRCCLSPDLSHYTVLGLTPLASQTEVKRAFKRLALKYHPDVHKG-----QDKDF 78 Query: 280 KEIKSAYESLMEKFEVEEELLTTDGXXXXXXXXXWMGFEGGIP 152 KEIKSAYE LM+KFE EEE + WMGFEGGIP Sbjct: 79 KEIKSAYECLMQKFEKEEEEMEITEMGEIDEWEEWMGFEGGIP 121 >ref|NP_565034.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] gi|332197149|gb|AEE35270.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] Length = 126 Score = 90.1 bits (222), Expect = 2e-16 Identities = 53/103 (51%), Positives = 65/103 (63%), Gaps = 2/103 (1%) Frame = -2 Query: 454 RGVSFQTRSL--PISDAFAVLGLTPFASKSDVKHAYKRLALKFHPDVIKGDNVNEKQETF 281 R + F TR P + VLGLTP AS+++VK A+KRLALK+HPDV KG + + F Sbjct: 24 RLIQFPTRCCLSPDLSHYTVLGLTPLASQTEVKRAFKRLALKYHPDVHKG-----QDKDF 78 Query: 280 KEIKSAYESLMEKFEVEEELLTTDGXXXXXXXXXWMGFEGGIP 152 KEIKSAYE LM+KF+ EEE + WMGFEGGIP Sbjct: 79 KEIKSAYECLMQKFKKEEEEMEITEMGEIDEWEEWMGFEGGIP 121 >ref|ZP_03544762.1| chaperone protein DnaJ [Comamonas testosteroni KF-1] gi|220713680|gb|EED69048.1| chaperone protein DnaJ [Comamonas testosteroni KF-1] Length = 376 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/57 (50%), Positives = 40/57 (70%) Frame = -2 Query: 415 DAFAVLGLTPFASKSDVKHAYKRLALKFHPDVIKGDNVNEKQETFKEIKSAYESLME 245 D + VLG+ AS D+K AY++LA+K+HPD +GD E +ETFKE+K AYE L + Sbjct: 5 DYYEVLGVAKSASDDDIKKAYRKLAMKYHPDRNQGDKAKEAEETFKEVKEAYEMLSD 61 >ref|ZP_13096525.1| chaperone protein DnaJ [Comamonas testosteroni ATCC 11996] gi|371452321|gb|EHN65350.1| chaperone protein DnaJ [Comamonas testosteroni ATCC 11996] Length = 377 Score = 64.7 bits (156), Expect = 8e-09 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = -2 Query: 415 DAFAVLGLTPFASKSDVKHAYKRLALKFHPDVIKGDNVNEKQETFKEIKSAYESLME 245 D + VLG+ AS D+K AY++LA+KFHPD +GD E +E FKE+K AYE L + Sbjct: 5 DYYEVLGVAKSASDDDIKKAYRKLAMKFHPDRNQGDKAKEAEEKFKEVKEAYEMLSD 61 >ref|YP_003277052.1| molecular chaperone DnaJ [Comamonas testosteroni CNB-2] gi|299530689|ref|ZP_07044104.1| chaperone protein DnaJ [Comamonas testosteroni S44] gi|262207658|gb|ACY31756.1| chaperone protein DnaJ [Comamonas testosteroni CNB-2] gi|298721205|gb|EFI62147.1| chaperone protein DnaJ [Comamonas testosteroni S44] Length = 376 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/57 (49%), Positives = 39/57 (68%) Frame = -2 Query: 415 DAFAVLGLTPFASKSDVKHAYKRLALKFHPDVIKGDNVNEKQETFKEIKSAYESLME 245 D + VLG+ AS D+K AY++LA+KFHPD +G+ E +E FKE+K AYE L + Sbjct: 5 DYYEVLGVAKSASDDDIKKAYRKLAMKFHPDRNQGEKAKEAEEKFKEVKEAYEMLSD 61