BLASTX nr result
ID: Coptis24_contig00032810
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00032810 (271 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173420.1| hypothetical protein NitaMp078 [Nicotiana tabac... 69 3e-10 >ref|YP_173420.1| hypothetical protein NitaMp078 [Nicotiana tabacum] gi|56806583|dbj|BAD83484.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 122 Score = 69.3 bits (168), Expect = 3e-10 Identities = 38/48 (79%), Positives = 40/48 (83%), Gaps = 2/48 (4%) Frame = +3 Query: 36 SRSYSYKGRGKESKSMEINEPSLMDVAHDMIN--*GPALIEVAYSPSS 173 SRS+S RGKESKSM+INEPSLMDVAHD IN GPALIEVAY PSS Sbjct: 18 SRSFSTLRRGKESKSMDINEPSLMDVAHDTINSTQGPALIEVAYFPSS 65