BLASTX nr result
ID: Coptis24_contig00032474
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00032474 (462 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] g... 60 2e-19 ref|XP_002535311.1| conserved hypothetical protein [Ricinus comm... 49 6e-10 ref|XP_002535312.1| 60S ribosomal protein L16, putative [Ricinus... 62 5e-08 gb|ABA99235.1| Mitochondrial ribosomal protein S3, putative, exp... 62 6e-08 gb|ABA99284.1| Mitochondrial ribosomal protein S3, putative [Ory... 62 6e-08 >ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] gi|355477354|gb|AES58557.1| Ribosomal protein S3 [Medicago truncatula] Length = 306 Score = 60.5 bits (145), Expect(2) = 2e-19 Identities = 29/34 (85%), Positives = 29/34 (85%) Frame = -1 Query: 234 MGQRIKRFYFVPRDPPQVGFASRVMGYYPARFGE 133 MGQRIKRF FV RD PQVGF SRVMG YPARFGE Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGE 34 Score = 59.7 bits (143), Expect(2) = 2e-19 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 92 SGSSHGGVTIDSIYYYGKSVYQDVNLRSFF 3 SG SHGGVTIDSIYYYGK VYQDVNLRS+F Sbjct: 35 SGYSHGGVTIDSIYYYGKLVYQDVNLRSYF 64 >ref|XP_002535311.1| conserved hypothetical protein [Ricinus communis] gi|223523476|gb|EEF27072.1| conserved hypothetical protein [Ricinus communis] Length = 63 Score = 48.5 bits (114), Expect(2) = 6e-10 Identities = 23/30 (76%), Positives = 26/30 (86%), Gaps = 2/30 (6%) Frame = +1 Query: 346 LRWSS--LIFPNVQSCSGLRKEHRPSALNE 429 +RWSS + FPNV+SCSGLRKEHRPS LNE Sbjct: 34 VRWSSRSVGFPNVKSCSGLRKEHRPSTLNE 63 Score = 40.0 bits (92), Expect(2) = 6e-10 Identities = 23/37 (62%), Positives = 26/37 (70%) Frame = +3 Query: 243 MLLPADQAATLLVIGVSGKPLTFGSDK*SPLGRFAQM 353 MLLPA AA +S KPL+FGSDK SP GRFAQ+ Sbjct: 1 MLLPASDAAR---DRLSFKPLSFGSDKSSPFGRFAQV 34 >ref|XP_002535312.1| 60S ribosomal protein L16, putative [Ricinus communis] gi|223523477|gb|EEF27073.1| 60S ribosomal protein L16, putative [Ricinus communis] Length = 668 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 92 SGSSHGGVTIDSIYYYGKSVYQDVNLRSFF 3 SGS HGGVTIDSIYYYGKSVYQDVNLRS+F Sbjct: 11 SGSFHGGVTIDSIYYYGKSVYQDVNLRSYF 40 >gb|ABA99235.1| Mitochondrial ribosomal protein S3, putative, expressed [Oryza sativa Japonica Group] Length = 748 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -2 Query: 128 CSLRW*M*APLSSGSSHGGVTIDSIYYYGKSVYQDVNLRSFF 3 C+ W SGSSHG VTIDSIYYYGKS+YQDVNLRS+F Sbjct: 16 CAGEWKPPPQKRSGSSHGSVTIDSIYYYGKSLYQDVNLRSYF 57 >gb|ABA99284.1| Mitochondrial ribosomal protein S3, putative [Oryza sativa Japonica Group] Length = 752 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -2 Query: 128 CSLRW*M*APLSSGSSHGGVTIDSIYYYGKSVYQDVNLRSFF 3 C+ W SGSSHG VTIDSIYYYGKS+YQDVNLRS+F Sbjct: 16 CAGEWKPPPQKRSGSSHGSVTIDSIYYYGKSLYQDVNLRSYF 57