BLASTX nr result
ID: Coptis24_contig00032423
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00032423 (227 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABC94893.1| polyprotein [Oryza australiensis] 58 9e-07 prf||1510387A retrotransposon del1-46 56 3e-06 gb|ADN33767.1| gag protease polyprotein [Cucumis melo subsp. melo] 56 3e-06 gb|ADN34141.1| ty3-gypsy retrotransposon protein [Cucumis melo s... 56 4e-06 >gb|ABC94893.1| polyprotein [Oryza australiensis] Length = 1469 Score = 57.8 bits (138), Expect = 9e-07 Identities = 30/69 (43%), Positives = 44/69 (63%) Frame = +3 Query: 18 LCVETPLGGSVTLYDECKNFKL*FLDHVFVVDLIVLGFEGFHFILGMDWLTRYHVTLDCA 197 + V +P GG +T+ C N + D VF+ +L+VL + ILGMDWLT+ + +DC+ Sbjct: 408 MLVHSP-GGDITVPHACINVPIRIRDVVFLSNLMVLSPQTIDVILGMDWLTKNNGIIDCS 466 Query: 198 RREVIVNTP 224 RREV V+TP Sbjct: 467 RREVTVSTP 475 >prf||1510387A retrotransposon del1-46 Length = 1443 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/70 (40%), Positives = 38/70 (54%) Frame = +3 Query: 18 LCVETPLGGSVTLYDECKNFKL*FLDHVFVVDLIVLGFEGFHFILGMDWLTRYHVTLDCA 197 L V +P+G S + CK + + VDLI+L E +LGMDWL YHV LDC Sbjct: 378 LSVISPIGTSTFVNQVCKGCMITIGNQELTVDLIILDLEDPDILLGMDWLAAYHVVLDCF 437 Query: 198 RREVIVNTPG 227 ++V + PG Sbjct: 438 SKKVTFHLPG 447 >gb|ADN33767.1| gag protease polyprotein [Cucumis melo subsp. melo] Length = 871 Score = 56.2 bits (134), Expect = 3e-06 Identities = 29/69 (42%), Positives = 38/69 (55%) Frame = +3 Query: 18 LCVETPLGGSVTLYDECKNFKL*FLDHVFVVDLIVLGFEGFHFILGMDWLTRYHVTLDCA 197 L V TP G + ++ K ++ HV V LIVL F ILGMDWL H ++DC+ Sbjct: 670 LSVSTPSGECMLSKEKVKACQIEIAGHVIEVTLIVLDMLDFDVILGMDWLAANHASIDCS 729 Query: 198 RREVIVNTP 224 R+EV N P Sbjct: 730 RKEVTFNPP 738 >gb|ADN34141.1| ty3-gypsy retrotransposon protein [Cucumis melo subsp. melo] Length = 1359 Score = 55.8 bits (133), Expect = 4e-06 Identities = 27/69 (39%), Positives = 38/69 (55%) Frame = +3 Query: 18 LCVETPLGGSVTLYDECKNFKL*FLDHVFVVDLIVLGFEGFHFILGMDWLTRYHVTLDCA 197 L V TP G + ++ K ++ HV V L+VL F ILGMDWL H ++DC+ Sbjct: 325 LSVSTPFGECMLSKEKVKACQIEIAGHVIEVTLLVLDMLDFDVILGMDWLAANHASIDCS 384 Query: 198 RREVIVNTP 224 R+E+ N P Sbjct: 385 RKEIAFNPP 393