BLASTX nr result
ID: Coptis24_contig00032377
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00032377 (579 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514722.1| pentatricopeptide repeat-containing protein,... 96 6e-18 ref|XP_002318601.1| predicted protein [Populus trichocarpa] gi|2... 95 7e-18 ref|XP_004138304.1| PREDICTED: pentatricopeptide repeat-containi... 94 1e-17 ref|XP_003550790.1| PREDICTED: pentatricopeptide repeat-containi... 94 2e-17 ref|XP_003622167.1| Pentatricopeptide repeat protein [Medicago t... 94 2e-17 >ref|XP_002514722.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223546326|gb|EEF47828.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 479 Score = 95.5 bits (236), Expect = 6e-18 Identities = 42/58 (72%), Positives = 50/58 (86%) Frame = -1 Query: 579 YGSVYDLLIPKLCRGGEFEKGRLLWDEAMKMGITLQCSSDVLDPTVTEVFMPNKKVEE 406 YG VYDLLIPKLC GG FEKG+ LWDEAM MG+T+ CSS+VLDP++T+VF P +KVEE Sbjct: 378 YGPVYDLLIPKLCIGGNFEKGKELWDEAMAMGVTVHCSSEVLDPSITKVFEPTRKVEE 435 >ref|XP_002318601.1| predicted protein [Populus trichocarpa] gi|222859274|gb|EEE96821.1| predicted protein [Populus trichocarpa] Length = 485 Score = 95.1 bits (235), Expect = 7e-18 Identities = 40/58 (68%), Positives = 50/58 (86%) Frame = -1 Query: 579 YGSVYDLLIPKLCRGGEFEKGRLLWDEAMKMGITLQCSSDVLDPTVTEVFMPNKKVEE 406 YG VYD+LIPKLC+GG+FE+GR LW+EA MG++ CSSDVLDP++TEVF P +KVEE Sbjct: 395 YGPVYDILIPKLCKGGDFERGRELWEEATAMGVSFSCSSDVLDPSITEVFKPRRKVEE 452 >ref|XP_004138304.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial-like [Cucumis sativus] gi|449477571|ref|XP_004155060.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial-like [Cucumis sativus] Length = 487 Score = 94.4 bits (233), Expect = 1e-17 Identities = 39/57 (68%), Positives = 50/57 (87%) Frame = -1 Query: 579 YGSVYDLLIPKLCRGGEFEKGRLLWDEAMKMGITLQCSSDVLDPTVTEVFMPNKKVE 409 YG VYD+LIPKLCRGGEFE GR LW+EAM MG++L CSS++LDP++T+VF P +K+E Sbjct: 402 YGPVYDVLIPKLCRGGEFEMGRQLWEEAMAMGVSLNCSSEILDPSITKVFKPTRKIE 458 >ref|XP_003550790.1| PREDICTED: pentatricopeptide repeat-containing protein At5g61370, mitochondrial-like [Glycine max] Length = 451 Score = 93.6 bits (231), Expect = 2e-17 Identities = 41/54 (75%), Positives = 47/54 (87%) Frame = -1 Query: 579 YGSVYDLLIPKLCRGGEFEKGRLLWDEAMKMGITLQCSSDVLDPTVTEVFMPNK 418 YG VYD+LIPKLCRGG+FEKGR LWDEA MGITLQCS DVLDP++TEV+ P + Sbjct: 359 YGPVYDVLIPKLCRGGDFEKGRELWDEASGMGITLQCSEDVLDPSITEVYKPTR 412 >ref|XP_003622167.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355497182|gb|AES78385.1| Pentatricopeptide repeat protein [Medicago truncatula] Length = 563 Score = 93.6 bits (231), Expect = 2e-17 Identities = 42/61 (68%), Positives = 53/61 (86%) Frame = -1 Query: 579 YGSVYDLLIPKLCRGGEFEKGRLLWDEAMKMGITLQCSSDVLDPTVTEVFMPNKKVEEVS 400 YG VYD+LIPKLCRGG+FEKGR LWDE MGITLQCS DVLDP++TEV++P K+ E+++ Sbjct: 466 YGPVYDVLIPKLCRGGDFEKGRELWDEGTYMGITLQCSKDVLDPSITEVYIP-KRPEKIN 524 Query: 399 M 397 + Sbjct: 525 V 525