BLASTX nr result
ID: Coptis24_contig00032344
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00032344 (458 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268521.1| PREDICTED: uncharacterized protein LOC100256... 62 5e-08 ref|XP_002297772.1| predicted protein [Populus trichocarpa] gi|2... 62 6e-08 ref|XP_002513115.1| conserved hypothetical protein [Ricinus comm... 61 8e-08 ref|NP_194884.1| high chlorophyll fluorescence 153 protein [Arab... 56 3e-06 ref|XP_002862560.1| hypothetical protein ARALYDRAFT_497397 [Arab... 56 3e-06 >ref|XP_002268521.1| PREDICTED: uncharacterized protein LOC100256905 [Vitis vinifera] Length = 133 Score = 62.0 bits (149), Expect = 5e-08 Identities = 32/56 (57%), Positives = 41/56 (73%) Frame = -3 Query: 168 RYSWNDKEKKNRGFVVVTRAGPPSNTSLIFAFVFPLTLLLATIFTSIRIADKLDED 1 R+S +K RG VVTRAGP S +S +FAFVFPL+LL TIFTS+R+ DKL+ + Sbjct: 37 RFSGELCRRKTRGLSVVTRAGP-STSSYVFAFVFPLSLLAVTIFTSLRVDDKLERE 91 >ref|XP_002297772.1| predicted protein [Populus trichocarpa] gi|222845030|gb|EEE82577.1| predicted protein [Populus trichocarpa] Length = 162 Score = 61.6 bits (148), Expect = 6e-08 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -3 Query: 168 RYSWNDKEKKNRGFVVVTRAGPPSNTSLIFAFVFPLTLLLATIFTSIRIADKLDED 1 R S + +K RG VVTRAG +N S + AF+ PL+LL ATIFTSIRIADKLD+D Sbjct: 32 RISDDPWRRKKRGLTVVTRAGLSAN-SYVLAFLLPLSLLAATIFTSIRIADKLDQD 86 >ref|XP_002513115.1| conserved hypothetical protein [Ricinus communis] gi|223548126|gb|EEF49618.1| conserved hypothetical protein [Ricinus communis] Length = 93 Score = 61.2 bits (147), Expect = 8e-08 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = -3 Query: 144 KKNRGFVVVTRAGPPSNTSLIFAFVFPLTLLLATIFTSIRIADKLDED 1 K RG ++ RAGP S +S +FAFVFPL+LL+ TI TSIRIADKLD D Sbjct: 40 KTRRGSALIPRAGP-STSSYVFAFVFPLSLLIGTIITSIRIADKLDRD 86 >ref|NP_194884.1| high chlorophyll fluorescence 153 protein [Arabidopsis thaliana] gi|11692862|gb|AAG40034.1|AF324683_1 AT4g31560 [Arabidopsis thaliana] gi|11908100|gb|AAG41479.1|AF326897_1 unknown protein [Arabidopsis thaliana] gi|12642912|gb|AAK00398.1|AF339716_1 unknown protein [Arabidopsis thaliana] gi|13926337|gb|AAK49632.1|AF372916_1 AT4g31560/F3L17_130 [Arabidopsis thaliana] gi|5262767|emb|CAB45915.1| putative protein [Arabidopsis thaliana] gi|7270059|emb|CAB79874.1| putative protein [Arabidopsis thaliana] gi|21592375|gb|AAM64326.1| unknown [Arabidopsis thaliana] gi|27363346|gb|AAO11592.1| At4g31560/F3L17_130 [Arabidopsis thaliana] gi|332660529|gb|AEE85929.1| high chlorophyll fluorescence 153 protein [Arabidopsis thaliana] Length = 137 Score = 55.8 bits (133), Expect = 3e-06 Identities = 29/48 (60%), Positives = 36/48 (75%) Frame = -3 Query: 144 KKNRGFVVVTRAGPPSNTSLIFAFVFPLTLLLATIFTSIRIADKLDED 1 ++ R VVTRAGP S +S + AF P TL+ AT+FTSI+IADKLDED Sbjct: 45 RRIRDSSVVTRAGP-STSSYLLAFAIPATLIAATVFTSIKIADKLDED 91 >ref|XP_002862560.1| hypothetical protein ARALYDRAFT_497397 [Arabidopsis lyrata subsp. lyrata] gi|297308158|gb|EFH38818.1| hypothetical protein ARALYDRAFT_497397 [Arabidopsis lyrata subsp. lyrata] Length = 137 Score = 55.8 bits (133), Expect = 3e-06 Identities = 29/48 (60%), Positives = 36/48 (75%) Frame = -3 Query: 144 KKNRGFVVVTRAGPPSNTSLIFAFVFPLTLLLATIFTSIRIADKLDED 1 ++ R VVTRAGP S +S + AF P TL+ AT+FTSI+IADKLDED Sbjct: 45 RRIRDCSVVTRAGP-STSSYLLAFAIPATLIAATVFTSIKIADKLDED 91