BLASTX nr result
ID: Coptis24_contig00031827
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis24_contig00031827 (225 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266568.2| PREDICTED: uncharacterized protein LOC100255... 57 2e-06 >ref|XP_002266568.2| PREDICTED: uncharacterized protein LOC100255461 [Vitis vinifera] Length = 1169 Score = 57.0 bits (136), Expect = 2e-06 Identities = 33/78 (42%), Positives = 43/78 (55%), Gaps = 5/78 (6%) Frame = +2 Query: 5 FDMKYN-AFKGRSQLPQHGQQRAN--VRKQPGVGKSYGNISRTHHTSVNIPSQPAQPAKE 175 +DMKY + K + P Q N VRKQ GV ++ N++ H +N P Q QP Sbjct: 127 YDMKYRVSLKHTAPKPPPHQLNRNSFVRKQYGVQNNFPNVANPHGVGLN-PHQQTQPGLS 185 Query: 176 --QPTFWTACPFCTMRYQ 223 Q TFWT CPFC++RYQ Sbjct: 186 DGQQTFWTCCPFCSIRYQ 203